SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000004863 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000004863
Domain Number 1 Region: 90-236
Classification Level Classification E-value
Superfamily C-type lectin-like 1.54e-33
Family C-type lectin domain 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000004863   Gene: ENSPPYG00000004264   Transcript: ENSPPYT00000005054
Sequence length 241
Comment pep:known_by_projection chromosome:PPYG2:12:10334101:10347019:1 gene:ENSPPYG00000004264 transcript:ENSPPYT00000005054 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHEEEMYSSLQWDSPAPDTYQKCLSSNKCSGACCLVMVISCIFCMGLLTASIFLGVKLLQ
VSTIAMQQQEKLIQQERALLNFTEWKRSHALQMKYCQAFMQNSLSSAHNSSPCPNNWIQN
RESCYYVSEIWSIWHTSQENCLKEGSTLLQIESKEEMDFITGSLRKIKGSYDYWVGLSQD
GHSGRWLWQDGSSPSPGLLPVERSQSTNQVCGYMKNNSLLSSNCSTWKYFICEKYALRSS
A
Download sequence
Identical sequences H2NGH2
XP_002822944.1.23681 ENSPPYP00000004863 9600.ENSPPYP00000004863 ENSPPYP00000004863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]