SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000004864 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000004864
Domain Number 1 Region: 92-263
Classification Level Classification E-value
Superfamily C-type lectin-like 1.03e-32
Family C-type lectin domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000004864   Gene: ENSPPYG00000004265   Transcript: ENSPPYT00000005055
Sequence length 280
Comment pep:known_by_projection chromosome:PPYG2:12:10353898:10384812:-1 gene:ENSPPYG00000004265 transcript:ENSPPYT00000005055 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQAKYSSTRDMLDDDGDTTMSLHSQASATTRRPEPRCTEHRAPSSTWRPVALTLLTLCLV
LLIGLAALGLLFFQYYQLSNTGQDTISQMEERLGNMSRELQSLQVQNIKLAGSLQHVAEK
LCRELYNKAGAHRCSPCTEQWKWHGDNCYQFYKDSKSWEDCKYFCLSENSTMLKINKQED
LDFAVSESYSEFFYSYWTGLLRPDSGKAWLWMDGTPFTSELFHIIIDVTSPRSRDCVAIL
NGMIFSKDCQELKRCVCERRAGMVKPENLHFPPEILGESD
Download sequence
Identical sequences H2NGH3
XP_002822945.1.23681 ENSPPYP00000004864 ENSPPYP00000004864 9600.ENSPPYP00000004864

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]