SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000004865 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000004865
Domain Number 1 Region: 104-245
Classification Level Classification E-value
Superfamily C-type lectin-like 8.22e-35
Family C-type lectin domain 0.0000771
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000004865   Gene: ENSPPYG00000004266   Transcript: ENSPPYT00000005056
Sequence length 247
Comment pep:known_by_projection chromosome:PPYG2:12:10402515:10415776:-1 gene:ENSPPYG00000004266 transcript:ENSPPYT00000005056 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEYHPDLENLDEDGYTQLHFDSRSNTRMAVVSEKGSCAASPPWRLIAVILGILCLVILVI
AVVLGTMAIWRSNSGSNTLENGYFPSRNKENHSQHTQSSLEESVTPTKAVKTTGVLSSPC
PPNWIIYEKSCYLFSMSLNSWDGSKRQCSQLGSNLLKIDSSNELGFIVKQVSSQPDNSFW
IGLSRPQTEVPWLWEDGSTFSSNLFQIRTTATQENPSPNCVWIHVSVIYDQLCSVPSYSI
CEKKFSM
Download sequence
Identical sequences H2NGH4
ENSPPYP00000004865 9600.ENSPPYP00000004865 XP_002822947.1.23681 ENSPPYP00000004865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]