SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000004872 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000004872
Domain Number 1 Region: 82-200
Classification Level Classification E-value
Superfamily C-type lectin-like 7.17e-34
Family C-type lectin domain 0.00000027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000004872   Gene: ENSPPYG00000004271   Transcript: ENSPPYT00000005063
Sequence length 203
Comment pep:novel chromosome:PPYG2:12:10676192:10691741:-1 gene:ENSPPYG00000004271 transcript:ENSPPYT00000005063 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EMSEFHNYNLDLAKNDFSTRWQKQRCPVIKSKCRENTSPLFFCCFIAVAMGIRFIVMVTI
WSAVFLNSLFNQEVQIPLTGNYCGPCPKNWICYKNNCYQFFNESKNWYESQASCMSQNAS
LLKVYSKEDQDLLKLVKSYHWMGLIHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYA
SSFKGYIENCSTPNTYICMQRTV
Download sequence
Identical sequences H2NGI1
9600.ENSPPYP00000004872 ENSPPYP00000004872 ENSPPYP00000004872

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]