SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000004879 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000004879
Domain Number 1 Region: 76-232
Classification Level Classification E-value
Superfamily C-type lectin-like 7e-34
Family C-type lectin domain 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000004879   Gene: ENSPPYG00000004274   Transcript: ENSPPYT00000005070
Sequence length 233
Comment pep:known_by_projection chromosome:PPYG2:12:10736646:10741763:-1 gene:ENSPPYG00000004274 transcript:ENSPPYT00000005070 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDNQGVIYSDLNLPPNPKRQQRKPKGNKSSILATEQEITYAELNLQKASQDFQEKDKTYH
CKDLPSAPEKLIVGILGIICLVLMASVVTIVVIPSTLIQKHNSSSLNTRTQKAHRCGHCR
EEWITYSNSCYYIGKEKRTWEESLLACASKNSSLLSIDNEEEMKFLGTILPSSWIGVFRN
SSHHPWVTINGLAFKQEIKDSDNAEHDCAVLHTRGLISDKCGSSKLYHCKHKL
Download sequence
Identical sequences H2NGI8
ENSPPYP00000004879 9600.ENSPPYP00000004879 XP_002822954.1.23681 XP_003778019.1.23681 ENSPPYP00000004879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]