SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000004882 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000004882
Domain Number 1 Region: 139-272
Classification Level Classification E-value
Superfamily C-type lectin-like 7e-30
Family C-type lectin domain 0.0000554
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000004882   Gene: ENSPPYG00000004276   Transcript: ENSPPYT00000005073
Sequence length 285
Comment pep:novel chromosome:PPYG2:12:10894129:10904763:-1 gene:ENSPPYG00000004276 transcript:ENSPPYT00000005073 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNDQGEIYSTLRFLQSPSESQNRLRPDDTQRPGKTDDKEFSVRWRLIAVTLGILCLLLLM
IITVLVTKIFQCIQEKHQQQAILRNCSEKYIMQNDNYLKEQLLTNKTLKYDVLKNDSFQQ
KKELDSHLIQKNRCHRENEIVFKVLQNTGKFSEDHWSCCGVSCYYFTMQKKDWKGCKQTC
QHCRASLLKIDDKDELAFIQSQIYENNYWIGLSYDERESKWKWIDNGTSPGIDSTIMRFS
SGRGECAFLTSTRMTTIDCIQMYNCICEKRTDSIFSDSVCAKKRR
Download sequence
Identical sequences H2NGJ1
XP_002822961.2.23681 XP_009245739.1.23681 ENSPPYP00000004882 ENSPPYP00000004882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]