SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000005012 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000005012
Domain Number 1 Region: 513-768
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.24e-85
Family Eukaryotic proteases 0.00014
Further Details:      
 
Domain Number 2 Region: 41-295
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.4e-73
Family Eukaryotic proteases 0.00059
Further Details:      
 
Domain Number 3 Region: 416-486
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000107
Family Spermadhesin, CUB domain 0.0035
Further Details:      
 
Domain Number 4 Region: 808-900
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000017
Family Spermadhesin, CUB domain 0.0085
Further Details:      
 
Domain Number 5 Region: 333-410
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000103
Family Spermadhesin, CUB domain 0.0065
Further Details:      
 
Domain Number 6 Region: 937-1017
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000106
Family Spermadhesin, CUB domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000005012   Gene: ENSPPYG00000004391   Transcript: ENSPPYT00000005210
Sequence length 1090
Comment pep:known_by_projection chromosome:PPYG2:12:30531786:30609134:-1 gene:ENSPPYG00000004391 transcript:ENSPPYT00000005210 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVLASAGLLLLLVIGHPRSLGLKCGIRMVNTKNKEPAVGSRFFSRISSWRNSTVTGHPW
QVSLKSEEHHFCGGSLIQEDRVVTAAHCLDNLSEKQLKNITVTSGKYSFFQKDKQEQNIP
VSKIITHPEYNSREYMSPDIALLYLKHKVKFGNAVQPICLPDSDDKVEPGILCLSSGWGK
ISKTSEYSNVLQEIELPIMDDRACNTVLKSMNLPPLGRTMLCAGFPDEGMDACQGDSGGP
LVCRRGGGIWILAGITSWVAGCAGGSAPVRNNHMKASLGIFSKVSELMDFITQNLFTGLD
RGQPLSKVGPSCITKALSSVQEVNGSQRGEGTLDMEKQVGCDHDYVSLPSSSGVLINQRS
LMEDDGKQNKRVCEKILPSPLLAETSEAMVPFVSDTEDSGSGFELTFTAVQNSEALSFED
FAVKFSPNCIYNAVVIYGDSEEEHKLAKLCGMLTITSIFSSSNMMVIHFKSDGKNRLQGF
KARFTILPSESLNKFEPKLPPQNNPVSTVKAILHDVCGIPPFSPQWLSRRIAGGEEACPH
CWPWQVGLRFLGDYQCGGAIINPVWILTAAHCVQSKNNPLSWTIIAGDHDRNLKESTEQV
RRAKHIIVHEDFNTLSYDSDIALIQLSSPLEYNSVVRPVCLPHSTEPLFSSEICAVTGWG
SISADGGLASRLQQIQVHVLEREVCEHTYYSAHPGGITEKMICAGFAASGERDFCQGDSG
GPLVCRHENGPFVLYGIVSWGAGCVQPWKPGVFARVMIFLDWIQSKINGPASLQTNNKCK
TLKQQLPPPTPSPDSASWPGCCSEAELEKPRGFFPTSRYLLDYRGRLECSWVLRVSPSSM
AKFTIEYLSLLGSPVCQDSVLIIYEERHSKRKMAGGLHGRRLYSMTFMSPGPLVRVTFHA
IVQGAFGISYIVLKVLGPKDSKITRLSQSSNREHLVPCEDVLLTKPEGIMQIPRNSHRTT
MGCQWRLVALLNHVIQLNIINFPMKPTTLVCHGHLHVYEEFGPKKLIASFAGTLAMILTR
DILKREKLNFINTYIMHIWENSVYDNVRSVGKRKQKKFASNLSYSMEAGKSRIQVPADLV
PAEGSLSGSW
Download sequence
Identical sequences H2NGW6
ENSPPYP00000005012 ENSPPYP00000005012 9600.ENSPPYP00000005012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]