SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000005114 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000005114
Domain Number 1 Region: 40-194
Classification Level Classification E-value
Superfamily Hedgehog/DD-peptidase 1.81e-79
Family Hedgehog (development protein), N-terminal signaling domain 0.000000259
Further Details:      
 
Domain Number 2 Region: 199-345
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 2.75e-36
Family Hedgehog C-terminal (Hog) autoprocessing domain 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000005114   Gene: ENSPPYG00000004480   Transcript: ENSPPYT00000005315
Sequence length 396
Comment pep:known_by_projection chromosome:PPYG2:12:48750552:48755511:-1 gene:ENSPPYG00000004480 transcript:ENSPPYT00000005315 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALLTNLLPLCCLALLALPAQSCGPGRGPVGRRRYARKQLVPLLYKQFVPGVPERTLGAS
GPAEGRVARGSERFRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPG
VRLRVTEGWDEDGHHAQDSLHYEGRALDITTSDRDRNKYGLLARLAVEAGFDWVYYESRN
HVHVSVKADNSLAVRAGGCFPGNATVRLWSGERKGLRELHRGDWVLAADASGRVVPTPVL
LFLDRDLQRRASFVAVETEWPPRKLLLTPWHLVFAARGPAPAPGDFAPVFARRLRAGDSV
LAPGGDALRPARVARVAREEAVGVFAPLTAHGTLLVNDVLASCYAVLESHQWAHRAFAPL
RLLHALGALLPGGAVQPTGMHWYSRLLYRLAEELLG
Download sequence
Identical sequences A0A2I3SDD4 G3QY79 H2NH66 O43323
ENSP00000266991 ENSPPYP00000005114 NP_066382.1.87134 NP_066382.1.92137 XP_002823229.1.23681 XP_003825875.1.60992 XP_004053122.1.27298 XP_016778990.1.37143 ENSPPYP00000005114 9600.ENSPPYP00000005114 9606.ENSP00000266991 ENSGGOP00000007809 ENSGGOP00000007809 ENSP00000266991 gi|19482158|ref|NP_066382.1| ENSP00000266991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]