SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000005166 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000005166
Domain Number 1 Region: 12-174
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.08e-38
Family Eukaryotic proteases 0.00000115
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000005166   Gene: ENSPPYG00000004527   Transcript: ENSPPYT00000005367
Sequence length 176
Comment pep:known_by_projection chromosome:PPYG2:12:51026050:51043455:-1 gene:ENSPPYG00000004527 transcript:ENSPPYT00000005367 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLPGHSTQDFPETNARVVGGTEAGRNSWPSQQKTFRVVAGDHNLSQNDGTEQSVSVQKI
VVHPYWNSDNVAANGQLAQTLQQAYLPSVDYTICSSSSYWGSTVKNTMVCAGGDGVRSGC
QGDSGGPLHCLVNGKYSVHGVTSFVSSRGCNVSKKPTVFTRVSAYISWINNVIASN
Download sequence
Identical sequences H2NHB4
9600.ENSPPYP00000005166 ENSPPYP00000005166 ENSPPYP00000005166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]