SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000005167 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000005167
Domain Number 1 Region: 158-487
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 7.31e-62
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.0000000241
Further Details:      
 
Domain Number 2 Region: 489-621
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.17e-31
Family Ricin B-like 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000005167   Gene: ENSPPYG00000004528   Transcript: ENSPPYT00000005368
Sequence length 622
Comment pep:known_by_projection chromosome:PPYG2:12:51049149:51081060:-1 gene:ENSPPYG00000004528 transcript:ENSPPYT00000005368 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLLRRRHMPLRLAMVGCAFVLFLFLLHRDVSSREEATEKPWLKSLVSRKDHVLDLMLEA
MNNLRDSMPKLQIRAPEAQQTLFSINQSCLPGFYTPAELKPFWERPPQDPNAPGADGKAF
QKSKWTPLETQEKEEGYKKHCFNAFASDRISLQRSLGPDTRPPECVDQKFRRCPPLATTS
VIIVFHNEAWSTLLRTVYSVLHTTPAILLKEIILVDDASTEEHLKEKLEQYVKQLQVVRV
VRQEERKGLITARLLGASVAQAEVLTFLDAHCECFHGWLEPLLARIAEDKTVVVSPDIVT
IDLNTFEFAKPVQRGRVHSRGNFDWSLTFGWETLPPHEKQRRKDETYPIKSPTFAGGLFS
ISKSYFEHIGTYDNQMEIWGGENVEMSFRVWQCGGQMEIIPCSVVGHVFRTKSPHTFPKG
TSVIARNQVRLAEVWMDSYKKIFYRRNLQAAKMAQEKSFGDISERLQLREQLHCHNFSWY
LHNVYPEMFVPDLTPTFYGAIKNLGTNQCLDVGENNRGGKPLIMYSCHGLGGNQYFEYTT
QRDLRHNIAKQLCLHVSKGALGLGSCHFTGKNSQVPKDEEWELAQDQLIRNSGSGTCLTS
QDKKPAMAPCNPSDPHQLWLFV
Download sequence
Identical sequences H2NHB5
ENSPPYP00000005167 XP_002823293.2.23681 XP_009246016.1.23681 XP_009246017.1.23681 XP_009246018.1.23681 XP_009246019.1.23681 9600.ENSPPYP00000005167 ENSPPYP00000005167

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]