SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000005345 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000005345
Domain Number 1 Region: 99-160
Classification Level Classification E-value
Superfamily Leucine zipper domain 0.0000968
Family Leucine zipper domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000005345   Gene: ENSPPYG00000004692   Transcript: ENSPPYT00000005554
Sequence length 169
Comment pep:known_by_projection chromosome:PPYG2:12:57332631:57339272:-1 gene:ENSPPYG00000004692 transcript:ENSPPYT00000005554 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASL
AWLTEEEPEPAEVTSTSQSPHSPDSSQSSLAQEEEEEDEGRTRKRKQSGHSPARAGKQRM
KEKEQENERKVAQLAEENERLKQEIERLTREVEATRRALIDRMVNLHQA
Download sequence
Identical sequences H2NHT6
XP_009246223.1.23681 9600.ENSPPYP00000005345 ENSPPYP00000005345 ENSPPYP00000005345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]