SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000005576 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000005576
Domain Number 1 Region: 1954-2048
Classification Level Classification E-value
Superfamily C-type lectin-like 2.64e-31
Family Link domain 0.00014
Further Details:      
 
Domain Number 2 Region: 1335-1490
Classification Level Classification E-value
Superfamily FAS1 domain 1.7e-29
Family FAS1 domain 0.0013
Further Details:      
 
Domain Number 3 Region: 741-892
Classification Level Classification E-value
Superfamily FAS1 domain 3.01e-28
Family FAS1 domain 0.0016
Further Details:      
 
Domain Number 4 Region: 288-418
Classification Level Classification E-value
Superfamily FAS1 domain 8.5e-25
Family FAS1 domain 0.0017
Further Details:      
 
Domain Number 5 Region: 907-1028
Classification Level Classification E-value
Superfamily FAS1 domain 1.96e-21
Family FAS1 domain 0.0049
Further Details:      
 
Domain Number 6 Region: 1499-1638
Classification Level Classification E-value
Superfamily FAS1 domain 2.62e-21
Family FAS1 domain 0.0044
Further Details:      
 
Domain Number 7 Region: 144-267
Classification Level Classification E-value
Superfamily FAS1 domain 2.22e-19
Family FAS1 domain 0.0011
Further Details:      
 
Domain Number 8 Region: 2044-2200
Classification Level Classification E-value
Superfamily FAS1 domain 0.00000000000000942
Family FAS1 domain 0.014
Further Details:      
 
Domain Number 9 Region: 1237-1276
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000024
Family EGF-type module 0.078
Further Details:      
 
Domain Number 10 Region: 1279-1317
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000565
Family Merozoite surface protein 1 (MSP-1) 0.086
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000005576
Domain Number - Region: 1148-1275
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000152
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number - Region: 1842-1878
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000156
Family EGF-type module 0.092
Further Details:      
 
Domain Number - Region: 1888-1921
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000733
Family EGF-type module 0.077
Further Details:      
 
Domain Number - Region: 628-680
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0017
Family EGF-like domain of nidogen-1 0.054
Further Details:      
 
Domain Number - Region: 1756-1879
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00345
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number - Region: 684-715
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00795
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 593-630
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0161
Family EGF-type module 0.036
Further Details:      
 
Domain Number - Region: 42-125,486-544
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0369
Family Growth factor receptor domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000005576   Gene: ENSPPYG00000004885   Transcript: ENSPPYT00000005790
Sequence length 2293
Comment pep:known_by_projection chromosome:PPYG2:12:105328010:105491427:1 gene:ENSPPYG00000004885 transcript:ENSPPYT00000005790 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IMLQHLVIFCLGFVVQNFCSPAETTGQARRCDRKSLLTIRTECRSCALNLGVKCPDGYTK
ITSGSVGVRDCRYTFEVRTYSLSLPGCRHICRKDYLQPQCCPGHWGPDCICVCQKGYVGD
GLTCYGNIMERLRELNTEPRGKWQGRLTSFISLLDKAYAWPLSKLGPFTVLLPTDKGLKG
FNVNELLVDNKAAQYFVKLHIIAGQMNTEYMNNTDTFYTLTGKSGEIFNSDKDNQIKLKL
HGGKKKVKIIQGDIIASNGLLHILDRAMDKLEPTFESNNEQTIMTMLQPRYSKFRSLLEE
TNLGHALDEDGVGGPYTIFVPSNEALNNMKDGTLDYLLSPEGSRKLLELVRYHIVPFTQL
EVATLISTPHIRSMANQLIQFNTTDNGQILANDVAMEEIEITAKNGRIYTLTGVLIPPSI
VPILPHRCDETKREMKLGTCVSCSLVYWSRCPANSEPTALFTHRCVYSGRFGSLKSGCAR
YCNATVKIPKCCKGFYGPDCNQCPGGFSNPCSGNGQCADSLGGNGTCICEEGFQGSQCQF
CSDPNKYGPRCNKKCLCVHGTCNNRIDSDGACLPGTCRDGSAGRLCDKQTSACGPYVQFC
HIHATCEYSNGTASCICKAGYEGDGTVCSEMDPCTGLTPGGCSRNAECIKTGTGTHTCVC
QQGWTGNGRDCLEINNCLLPSAGGCHDNATCLYVGPGQNECECKKGFRGNGIDCEPITSC
LEQTGKCHPLANCQSTTSGIWSCVCQEGYEGDGFLCYGNAAVELSFLSEAAVFNRWINNA
SLQPTLSATSNLTVLVPSQQATEDMDQDEKSFWLSQSNIPALIKYHMLLGTYRVADLQTL
SSSDMLATSLQGNFLHLAKVDGNITIEGASIVDGDNAATNGVIHIINKVLVPQRRLTGSL
PNLLMRLEQMPDYSIFRGYIIQYNLANAIEAADAYTVFAPNNNAIENYIREKKVLSLEED
VLRYHVVLEEKLLKNDLHNGMHRETMLGFSYFLGFFLHNDQLYVNEAPINYTNVATDKGV
IHGLGKVLEIQKNRCDNNDTTIIRGRCRTCSSELICPFGTKSLGNEKRRCIYTSYFMGRR
TLFIGCQPKCVRTVITRECCAGFFGPQCQPCPGNAQNVCFGNGICLDGVNGTGVCECGEG
FSGTACETCTEGKYGIHCDQVCSCVHGRCNQGPLGDGSCDCDVGWRGVHCENATTEDNCN
GTCHTSANCLPNSDGKASCKCAAGFQGNGTICTAINACEISNGGCSAKADCKRTTPGSRV
CTCKAGYTGDGIVCLEINPCLENHGGCDKNAECTQTGPNQAACNCLPAYTGDGKVCTLIN
VCLTKNGGCSEFAICNHTGQGERTCTCKPNYIGDGFTCRGSIYQELPKNPKTSQYFFQLQ
EHFVKDLVGPGPFTVFAPLSAAFDEEARVKDWDKQGLMPQVLRYHVVACHQLLLENLKLI
SNATSLQGEPIVISVSQGTVYINNKAKIISSDIISTNGIVHIIDKLLSPKNLLITPKDTS
GRILQNLTTLATNNGYIKFSNLIQITDPIHTPVTLFWPTDQALHALPAEQQDFLFNQDNK
DKLKEYLKFHVIRDAKVLAVDLPTSTAWKTLQGSELSVKCGAGSDIGDLFLNGQTCRIVQ
RELLFDLGVAYGIDCLLIDPTLGGRCDTFTTFDASGECGSCVNTPGCPRWSKPKGVKQKC
LYNLPFKRNLEGCRERCSLVIQIPRCCKGYFGRDCQACPGGPDAPCNNRGVCLDQYSATG
ECKCNTGFNGTACEMCWPGRFGPDCLPCGCSDHGQCDDGITGSGQCLCETGWTGPSCDTQ
AVLPAVCMPPCSAHATCKENNTCECNLDYEGDGITCTVVDFCKQDNGGCAKVARCSQKDT
KVFCSCQKGYKGDGHSCTEIDPCADGLNGGCHEHATCKMTGPGKHKCECKSHYVGDGLNC
EPEQLPIDRCLQDNGQCHADAKCVDLHFQDTTVGVFHLRSPLGQYKLTFDKARDACANEA
ATMATYNQLSYAQKAKYHLCSAGWLESGRVAYPTAFASQNCGSGVVGIVDYGPRPNKSEM
WDVFCYRMKDVNCTCKAGYVGDGFSCSGNLLQVLMSFPSLTNFLTEVLAYSNSSARGRAF
LEHLTDLSIRGTLFVPQNSGLGENETLSGQDIEHHLANVSMFFYNDLVNGTTLQTRLGSK
LLITASQDPLQPTEFVDGRAILQWDIFASNVKKRVISRPLKAPPAFRTLTHTGLGAGIFF
AIILVIGAAALAAYSYFRINRRTIGFQHFESEEDINVAALGKQQPENISNPLYESTTSAP
PEPSYDPFTDSEE
Download sequence
Identical sequences H2NIF8
9600.ENSPPYP00000005576 ENSPPYP00000005576 ENSPPYP00000005576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]