SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000005584 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000005584
Domain Number 1 Region: 147-272
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 3.26e-33
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.000000242
Further Details:      
 
Domain Number 2 Region: 10-138
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.53e-25
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000129
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000005584   Gene: ENSPPYG00000004893   Transcript: ENSPPYT00000005798
Sequence length 277
Comment pep:known_by_projection chromosome:PPYG2:12:106082274:106161359:1 gene:ENSPPYG00000004893 transcript:ENSPPYT00000005798 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGPEDLPESYDYDLIIIGGGSGGLAAAKEAAQYGKKVMVLDFVTPTPLGTRWGLGGTCV
NVGCIPKKLMHQAALLGQALQDSRNYGWKVEETTGKPVTDEEQTNVPYIYAIGDILEDKV
ELTPVAIQAGRLLAQRLYAGSTVKCDYENVPTTVFTPLEYGACGLSEEKAVEKFGEENIE
VYHSYFWPLEWTIPSRDNNKCYAKIICNTKDNERVVGFHVLGPNAGEVTQGFAAALKCGL
TKKQLDSTIGIHPVCAEVFTTLSVTKRSGASILQAGC
Download sequence
Identical sequences H2NIG5
ENSPPYP00000005584 9600.ENSPPYP00000005584 ENSPPYP00000005584

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]