SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000005589 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000005589
Domain Number 1 Region: 417-906
Classification Level Classification E-value
Superfamily ALDH-like 4.32e-165
Family ALDH-like 0.000000000769
Further Details:      
 
Domain Number 2 Region: 23-207
Classification Level Classification E-value
Superfamily Formyltransferase 3.92e-33
Family Formyltransferase 0.000000066
Further Details:      
 
Domain Number 3 Region: 211-311
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 6.28e-26
Family Post formyltransferase domain 0.0000139
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000005589
Domain Number - Region: 329-402
Classification Level Classification E-value
Superfamily ACP-like 0.000216
Family Acyl-carrier protein (ACP) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000005589   Gene: ENSPPYG00000004898   Transcript: ENSPPYT00000005804
Sequence length 907
Comment pep:known_by_projection chromosome:PPYG2:12:106780047:106845459:-1 gene:ENSPPYG00000004898 transcript:ENSPPYT00000005804 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRRGSQALRRFSTGRVYFKSKLKLALIGQSLFGQEVYSHLCKEGHRVVGVFTVPDKDGK
ADPLALAAEKDGTPVFKLPKWRVKGKTIKEVAEAYRSVGAELNVLPFCTQFIPMDIDSPK
HGSIIYHTLIMGDKKAGFSVFWADDGLDTGPILLQRSCDVEPNDTVDALYNRFLFPEGIK
AMVEAVQLIADGKAPRIPQPEEGATYEGIQKKENAEISWDQSAEVLHNWIRGHDKVPGAW
TEINGQMVTFYGSTLLNSSVPPGEPLEIKGAKKPGLVTKNGLVLFGNDGKALMVRNLQFE
DGKMIPASQYFSAGETSVVELTAEEVKVAETIKDIWAGILSNVPVIEDSTDFFKSGASSM
DVARLVEEIRQKCGGLQLQNEDVYMATKFEDFIQKVVRKLRGEDQEVELVVDYISKEVNE
MMVKMPYQCFINGRFTDADDGKTYDTINPTDGSTIGKVSYASLADVDKAVAAAKDAFENG
EWGRMNARERGRLMYRLADLLEENQEELATIEALDSGAVYTLALKTHIGMSVQTFRYFAG
WCDKIQGSTIPINQARPNRNLTFTKKEPLGVCAIIIPWNYPLMMLAWKSAACLAAGNTLV
LKPAQVTPLTALKFAELSVKAGFPKGVINIIPGSGGIAGQRLSEHPDIRKLGFTGSTPIG
KQIMKSCAVSNLKKVSLELGGKSPLIIFNDCELDKAVRMGMGAVFFNKGENCIAAGRLFV
EESIHDEFVTRVVEEIKKMKIGDPLDRSTDHGPQNHKAHLEKLLQYCETGVKEGATLVYG
GRQVQRPGFFMEPTVFTDVEDYMYLAKEESFGPIMVISKFQNGDVDGVLQRANNTEFGLA
SGVFTRDINKAMYVSEKLEAGTVFINTYNKTDVAAPFGGVKQSGFGKDLGEEALNEYLKT
KTVTLEY
Download sequence
Identical sequences H2NIH0
ENSPPYP00000005589 ENSPPYP00000005589 9600.ENSPPYP00000005589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]