SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000005650 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000005650
Domain Number 1 Region: 9-120
Classification Level Classification E-value
Superfamily DNA clamp 0.00000000000000408
Family DNA polymerase processivity factor 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000005650   Gene: ENSPPYG00000004951   Transcript: ENSPPYT00000005866
Sequence length 376
Comment pep:known_by_projection chromosome:PPYG2:12:112289603:112321263:1 gene:ENSPPYG00000004951 transcript:ENSPPYT00000005866 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKCVMSGSQVKVFGKAVQALSRISDELWLDPSKKGLALRCVNSSRSAYGCVLFSPVFFQ
HYQWSALVKMSENELDTTLNLKCKLGMKSILPIFRCLNSLERNIEKCRIFTRSDKCKVVI
QFFYRHTLMIQPRLLADAIFLFTSSQEEVTLAVTPLNFCLKSSNEESMDLSNAVYSEMFV
GSDEFDFFQIGMDTEITFCFKELKPLALSIDDMLVEANFILATLADEPSRASSPQSLCLS
QKRKRSDLIEKKAGKNVTGQALECISRKAAPRRLYPKETLTNISALENCGSPAVKRVVGD
VSEVSESSVSNTEEVPGSLCLRKFSCMFFGAVSSDQQEHFNHPFDSLARASDSEEDINNV
CCRKFNGSDAKYFCII
Download sequence
Identical sequences H2NIM8
ENSPPYP00000005650 9600.ENSPPYP00000005650 ENSPPYP00000005650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]