SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000005702 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000005702
Domain Number 1 Region: 215-523
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 5.1e-33
Family Quinoprotein alcohol dehydrogenase-like 0.02
Further Details:      
 
Domain Number 2 Region: 116-200
Classification Level Classification E-value
Superfamily F-box domain 1.44e-21
Family F-box domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000005702   Gene: ENSPPYG00000005001   Transcript: ENSPPYT00000005920
Sequence length 596
Comment pep:known_by_projection chromosome:PPYG2:12:118971810:119092924:1 gene:ENSPPYG00000005001 transcript:ENSPPYT00000005920 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDYSLDEFRRRWQEELAQAQAPKKRRRPEVAERRARRPEVGSGHGEQASGDPTLAQGLL
EGAGRPPAARATRAEGQVTSRSRSPLAREGAGGEQLVDQLIRDLNEMNDVPFFDIQLPYE
LAINIFQYLDRKELGRCAQVSKTWKVIAEDEVLWYRLCQQEGHLPDSSISDYSCWKLIFQ
ECRAKEHMLRTNWKNRKGAVSELEHVPDAVLRDVHSHDGVVIAGYTSGDVRVWDTRTWDY
VAPFLESEDEEDEPGMQPNVSFVRINSSLAVAAYEDGFLNIWDLRTGKYPVHRFEHDARI
QALALSQDDATVATASAFDVVMLSPNEEGYWQIAAEFEVPKLVQYLEIVPETRRYPVAVA
AAGDLMYLLKAEDSARTLLYAHGPPVTCLDVSANQVAFGVQGLGWVYEGSKILVYSLEAG
CRLLKLGNVLRDFTCVNLSDSPPNLMVSGNTDGRVRIHDLRSGNIALSLSAHQLRVSAVQ
MDDWKIVSGGEEGLVSVWDYRTNQKLWEVYSGHPVQHISFSSHSLITANVPYQTVMRNAD
LDSFTTHRRHRGLIRAYEFAVDQLAFQSPLPVCRSSCDAMATHYYDLALAFPYNHV
Download sequence
Identical sequences H2NIS9
9600.ENSPPYP00000005702 ENSPPYP00000005702 ENSPPYP00000005702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]