SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000005783 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000005783
Domain Number 1 Region: 106-157
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.0000948
Family VPS37 C-terminal domain-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000005783   Gene: ENSPPYG00000005076   Transcript: ENSPPYT00000006004
Sequence length 285
Comment pep:known_by_projection chromosome:PPYG2:12:125224555:125255092:-1 gene:ENSPPYG00000005076 transcript:ENSPPYT00000006004 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGAGSEARFAGLSLVQLNELLEDEGQLTEMVQKMEETQNVQLNKEMTLASNRSLAEGNL
RYQPQLDTLKARLTQKYQELQVLFEAYQIKKTKLDRQSSSASLETLLALLQAEGAKIEED
TENMAEKFLDGELPLDSFIDVYQSKRKLAHMRRVKIEKLQEMVLKGQRLPQALAPLPPRL
PELAPTAPLPYPAPEASGPPAVAPRRIPPPPPPVPAGRLATPFTAAMSSGQAVPYPGLQC
PPLPPRVGLPTQQGFSSQFVSPYPPPLPQRPPPRLPPHQPGFILQ
Download sequence
Identical sequences H2NJ06
XP_002823959.1.23681 ENSPPYP00000005783 ENSPPYP00000005783 9600.ENSPPYP00000005783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]