SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000005855 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000005855
Domain Number 1 Region: 134-421
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 3e-45
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.000000729
Further Details:      
 
Domain Number 2 Region: 426-562
Classification Level Classification E-value
Superfamily Ricin B-like lectins 4.81e-23
Family Ricin B-like 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000005855   Gene: ENSPPYG00000005137   Transcript: ENSPPYT00000006080
Sequence length 569
Comment pep:known_by_projection chromosome:PPYG2:12:135262075:135434664:-1 gene:ENSPPYG00000005137 transcript:ENSPPYT00000006080 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVARKIRTLLTVNILVFVGIVLFSVYCRLQGRSQELVRIVSGDRRVRSRHAKVGALGDR
EAILQRLDHLEEVVYNQLNGLAKPIGLVEGPGGLGQGGLAATLRDDGQEAEGKYEEYGYN
AQLSDRISLDRSIPDYRPRNTQDLPQVSVVFIFVNEALSVILRSVHSVVNHTPSQLLKEV
ILVDDNSDNVELKFNLDQYVNKRYPGLVKIVRNSRREGLIRARLQGWKAATAPVVGFFDA
HVEFNTGWAEPALSRIREDRRRIVLPAIDNIKYSTFEVQQYANAAHGYNWGLWCMYIIPP
QDWLDRGDESAPIRTPAMIGCSFVVDREYFGDIGLLDPGMEVYGGENVELGMRVWQCGGS
MEVLPCRVAHIERTRKPYNDIDYYAKRNPGVDFGDVSERLALRQRLKCRSFKWYLENVYP
EMRIYNNTLTYGEVRNSKASGYCLDQGAEDGDRAILYPCHGMSSQLVRYSADGLLQLGPL
GSTAFLPDSKCLVDDGRGRMPTLKKCEDVARPTQRLWDFTQSGPIVSRATGRCLEVEMSK
DANFGLRLVVQRCSGQKWMIRNWIKHARH
Download sequence
Identical sequences H2NJ67
ENSPPYP00000005855 ENSPPYP00000005855 9600.ENSPPYP00000005855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]