SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000005997 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000005997
Domain Number 1 Region: 2476-2665
Classification Level Classification E-value
Superfamily BRCA2 helical domain 3.01e-87
Family BRCA2 helical domain 0.0000000321
Further Details:      
 
Domain Number 2 Region: 2828-2964
Classification Level Classification E-value
Superfamily BRCA2 tower domain 1.96e-56
Family BRCA2 tower domain 0.0000018
Further Details:      
 
Domain Number 3 Region: 3049-3181
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.48e-54
Family Single strand DNA-binding domain, SSB 0.00000579
Further Details:      
 
Domain Number 4 Region: 2666-2797
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.88e-45
Family Single strand DNA-binding domain, SSB 0.000000802
Further Details:      
 
Domain Number 5 Region: 2799-2828,2966-3048
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 7.88e-37
Family Single strand DNA-binding domain, SSB 0.0000193
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000005997   Gene: ENSPPYG00000005264   Transcript: ENSPPYT00000006232
Sequence length 3415
Comment pep:known_by_projection chromosome:PPYG2:13:31850770:31940736:1 gene:ENSPPYG00000005264 transcript:ENSPPYT00000006232 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVGSKERPTFFEIFKTRCNKADLGPISLHWFEELSSEAPPYNSEPAEESEHKNNNYEPN
LFKTPQRKPSYNQLASTPIIFKEQGLTLPLYQSPVKELDKFRLDLGRNVPNSRHKSLRTV
KTKMDQADDVSCPLLSSCLSESPVVLQCTHVTPQRDKSVVCGSLFHTPKYVKGRQTPKHI
SESLGAEVDPDMSWSSSLATPPTLSSTVLIVRNEEASETVFPHDTTANVKSYFSNHDENL
KKNDRFIPSVTDSENTDQREATSHGFDKTLGNSFKVNSCKDHIGKSMPNVLEDEVYETVA
DTSEEVSFSLCFSKYRTRNLQKVRTSKTRKKIFHEANADECEKSKNQVKEKYSFVSEVEP
NDTDPLDSNVANQKPFESGSDKISKEVVPSLACEWSQLTLSGLNGTQMEKIPLLHISSCD
QNISEKDLLDTENKRKKDFLTSENSLPHISSLPKSEKPLNEETVVNKRDEEQHLESHRDC
ILAVKQAISGTSPVASSFQGIKKSIFRIRESPKETFNASFSGHMTDPNFKKETEASESGL
EIHTVCSQKEDSLCPNSIDNGSWPATTTQTSVASKNAGLISTLKKKTNKFIYAIHDETSY
KGKKMPKDQKSELINCSAQFEANAFEAPLTFANADSGLLHSSVKRSCSQNDSEEPTLSLT
SSFGTILRKCSRNETCSNNTVISQDLDYKEAKCNEEKLQLFITPEADSLSCLQEGQCEND
PKSKKVSDIKEEVLAAACHPVQDSKVEYSDTDFQSQKSLLYDHENASTLILTPTSKDVLS
NLVMISRGKESYKMSDKLKGNNYESDVELTKNIPMEKNQDICASNENDKNVELLPPEKYI
RVASPSRKVQFNQNTNLRVIQKNQEETTSISKITVNPDSEELFLDIENDFVFQVANERNN
LALGNTKELHETDLTCVNEPIFKNSTMVLYGDIGDKQATQVSIKKDLVYVLAEENKNSVK
QHIKMTLGQDLKSDVLNIDKIPDKNNDYMDKSAGLLGPISNHSFGGGFRTASNKEIKLSE
HNIKKSKMFFRDIEEQYPTSLACVEIVNTLALDNQKKLSKPQSINTVSAHLPSSVVVSDC
KNSHITPQMLFSKQDFNSNHNLTPSQKAEITELSTILEESGSQFEFTQFRKPSYILQKNT
FEVPENQMTILNTTSEECRDADLHVIMNAPSIGQVDSSKQFEGTVGIKQKFAGLLKNDCN
KSAAGYLTDENEVGFRGFYSAHGAKLNVSTEALQKAVKLFSDIENIGEETSAEVDPISLS
SSKCHDSVVSMFKTENHDKTVSEKNNICQLILQNNIEMTSGTFVEEITENYKRNTENEDN
KYTAASRNSHNLEFDGSDSSKNDTVCIHKDETDLLFTDQHNICLKLSGQFMKEGNTQIKE
DLSDLTFLEVVKAQETCHGNTSNKEQLTATKTEQNIKGFETFDTSFQTASGKNISVAKES
FNKIVNFFDQKPEELHNFSLNSELHSDIRKNKMDILSHEETDIVKNKILKESVPVGTGNQ
LVTFQEQPERDEKIKEPTLLGFHTASGKKVKIAKESLDKVKNLFDEKEQGTCEITSFSHQ
WAKTLKYRDARKDLELARETIEITTAPKCKEMQNSRNNDKNLVSIETVVPPKLLSDNLCR
QTENLKTSKSIFLKVKVHENVEKETAKSPATCYTNQSPYSVIENSALAFYTSCSRKTSVS
QTSLTEAKKWLREGIFDGQPERVNTADYVGNSLYESNSNTIAENDKNHLSEKQDTYLSNS
SMSNSYSYHSDEVHNDSGYLSKNKLDSGIEPVLKDVEDQKNTSFSKVISNVKDANAYPQT
VNEDICVEELVTSSSPCENKNAAIKLSISNSNNFAVGPPAFRIASGKIICVSHETIKKVK
DIFTDSFSKVIKENNENKSKICQKKIVAGCYEALDDSEDILHNSLDNDECSMHSHKVFAD
IQSEEVLQHNQNMSGLEKVSKISACDVSLETSDICKCSIGKLPKSVSSTNTCGIFSTASG
KSVQISDASLQKARQVFSEIEDSTKQVFSKVLFKSNEHSDQLTRQENTAIHTPENLTSQK
GFSYNVVNSSAFSGFSTASGKQVSILEGSLHEVKGVLEEFDLIRTEHSLHYSPTSRQNVS
KILPCVDKRNPEHSVNSEMEKTCSKEFKLSNNFNVEGGSSENNHSIKVSPYLSQFQQDKQ
QLVLGTKVSLVENIHVLGKEQTSPENVKMEMGKTETFSDVPVKTNIEVCSTYSKDSENYF
ETEAVEIAKAFMEDDELTDSELPSHATHSLFTCPKNEEMFLSNSRIGKRRGEPLISVGEP
PIKRNLLNEFDRIIANQEKSLKASKSTPDGTIKDRRLFMHHVSLEPITCVPFCTTKERQE
IQNPNFTAPGQEFLSKSRLYEHLTLEKSSSNLAVSGHPFYQVSATRNEKMKHLITTGKPT
KVFVPPFKTKSHFHRDEQCVRNINLEENKQKQNIDGHGSGDSKNKINDTEIHQFIKNNSN
QAAAVIFTKCEEEPLDLITSLQNARDIQDMRIKKKQRQRIFPQPGSLYLAKTSTLPRISL
KAAVGGQVPSACSHKQLYTYGVSKHCIKINSKNAESFQFHTEDYFGKENLWTGKGVQLAD
GGWLIPSNDGKAGKEEFYRALCDTPGVDPKLISRIWVYNHYRWIIWKLAAMECAFPKEFA
NRCLSPERVLLQLKYRYDMEIDRSRRSAIKKIMERDDTAAKTLVLCVSDIISLSANISET
SSNKTSSADTQKVAIIELTDGWYAVKAQLDPPLLAVLKNGRLTVGQKIILHGAELVGSPD
ACTPLEAPESLMLKISANSTRPACWYTKLGFFPDPRPFPLPLSSLFSDGGNVGCVDVIIQ
RAYPIQWMEKTSSGLYIFRNEREEEKEAAKYVEAQQKRLEALFTKFQEEFEEHEENTTKP
YLPSRALTRQQVRALQDGAELYEAVKNAADPAYLEGYFSEEQLRALNNHRQMLNDKKQAQ
IQLEIRKAMESAEQKEQGLSRDVTTVWKLRIVSYSKKEKDSVILSIWRPSSDLYSLLTEG
KRYRIYHLATSKSKSKSERANIQLAATKKTQYQQLPVSDEILFQVYQPREPLHFSKFLDP
DFQPSCSEVDLIGFVVSVVKKTGLAPFVYLSDECYNLLAIKFWIDLNEDIIKPHMLIAAS
NLQWRPESKSGLPTLFAGDFSVFSASPKEGHFQETFNKMKNTVENVDILCNEAENKLMHI
LHANDPKWSTPSKDCTSGPYTAQIIPGTGNKLLMSSPNCEIYYQSPLSFCMAKRKSVSTP
VSAQMTSKSCKGEKEIDDQKNCKKRRALDFLSRLPLPPPVSPICTFVSPAAQKAFQPPRS
CGTKYETPIKKKELNSPQMTPFKKFNEISLLESNSIADEELALINTQALLSGSTGEKQFI
SVSESTRTAPTSSKDYLRLKRRCTTSLIKEQESSQAGTEECEKNKQDTVTTKKYI
Download sequence
Identical sequences H2NJK5
9600.ENSPPYP00000005997 ENSPPYP00000005997 ENSPPYP00000005997

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]