SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000006179 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000006179
Domain Number 1 Region: 4-454
Classification Level Classification E-value
Superfamily 2-methylcitrate dehydratase PrpD 6.41e-118
Family 2-methylcitrate dehydratase PrpD 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000006179   Gene: ENSPPYG00000005423   Transcript: ENSPPYT00000006423
Sequence length 481
Comment pep:known_by_projection chromosome:PPYG2:13:78380358:78389802:1 gene:ENSPPYG00000005423 transcript:ENSPPYT00000006423 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMLKSVTESFATAIHGLKVGHLTDRVIQRSKRMILDTLGAGFLGTTTEVFHKASQYSKIY
SSNISSTVWGRPDIRLPPTYAAFVNGVAIHSMDFDDTWHPATHPSGAVLPVLTALAEALP
RSPKFSGLDLLLAFNVGIEVQGRLLHFAKEANDIPKRFHPPSVVGTLGSAAAASKFLGLS
STKCQEALAIAVSHAGAPMANAATQTKPLHIGNAAKHGIEAAFLAMLDLQGNKQVLDLEA
GFGAFYANYSPKVLPNLDSYSWLLDQQDVAFKRFPAHLSTHWVADAAASVRKHLVAERAL
LPIDYIKRIVLRIPNVQYVNRPFPDSEHEARHSFQYMACAMLLDGGITVPSFHECQINRP
QVRELLSKVELEHPPDNLPSFNTLYCEISVTLKDGATFTGRSDTFYGHWRKPLRQEDLEE
KFRANASKMLSWDTVESLIKIVENLEDLEDCSVLTTLLKGPSPPEVASNSPACNNSITNL
S
Download sequence
Identical sequences H2NK30
XP_002824396.2.23681 9600.ENSPPYP00000006179 ENSPPYP00000006179 ENSPPYP00000006179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]