SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000006210 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPPYP00000006210
Domain Number - Region: 134-171
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000141
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number - Region: 184-229
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.0235
Family RILP dimerisation region 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000006210   Gene: ENSPPYG00000005450   Transcript: ENSPPYT00000006455
Sequence length 754
Comment pep:known_by_projection chromosome:PPYG2:13:97913987:97972990:-1 gene:ENSPPYG00000005450 transcript:ENSPPYT00000006455 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQAEAADWLSSMVDWRRLSAIDVDKVAGAVDVLTLQENIMNITFCKLEDEKCPHCQSGVD
PVLLKLIRLAQFTIEYLLHSQEFLTSQLHTLEERLRLSHCDGEQSKKLLTKQAGEIKTLK
EECKRRKKMISTQQLMIEAKANYYQCHFCDKAFMNQAFLQSHIQRRHTEENSRFEYQKNA
QIEKLRSEIVVLKEELQLTRSELEAAHHASAVRFSKEYEMQKTKEEDFLKLFDRWKEEEK
EKLVDEMEKVKEMFMKEFKELTSKNSALEYQLSEIQKSNMQIKSNIGTLKDAHEFKEDRS
PYPQDFHNVMQLLDSQESKWTARVQAIHQEHKKEKGRLLSHIEKLRTSMIDDLNASNVFY
KKRIEELGQRLQEQNELIITQRQQIKDFTCNPLNSISEPKGNPLAWQAFESQPAAPAVPM
NAPALHTLETKSSLPMAHEQAFSSHILEPIEELSEEEKGRENEQKLNNNKMHLRKALKSN
SSFTKGLRTMVEQSLMEKLETLGINADIHGISSDQLHRVLKSVESERHKQEREIPNFHQI
REFLEHQVSCKIEEKALLSLDKCSVSQMDTLSTGEVPKMIQLPSKNRQLIRQKAVSTDRT
SVPKIKKNIMEDPFPRKSSTITTPPFSSEEEQEDDDLIRAYASPGPLPVPPLQNKGSFGK
NTVKSDADGTEGSEIEDTDDSPKPAGAAIKTPTEKVEKMFPHHKNVNKPVSGTNVPEMFI
KKEELQELKLQENESSTLKSSLVTVTDWSDTSDV
Download sequence
Identical sequences H2NK58
9600.ENSPPYP00000006210 ENSPPYP00000006210 ENSPPYP00000006210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]