SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000006251 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000006251
Domain Number 1 Region: 27-128
Classification Level Classification E-value
Superfamily E set domains 0.0000000000001
Family Filamin repeat (rod domain) 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000006251   Gene: ENSPPYG00000005483   Transcript: ENSPPYT00000006497
Sequence length 502
Comment pep:known_by_projection chromosome:PPYG2:13:105157150:105171324:-1 gene:ENSPPYG00000005483 transcript:ENSPPYT00000006497 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFGTLLLYCFFLAAVPALAETGGERQLSPEKSEIWGPGLKADVVLPARYFFIQAVDTSGN
KFTSSPGEKVFQVKVSAPEEQFTRVGVQVLDRKDGSFIVRYRMYASYKNLKVEVKFQGQH
VAKSPYILKGPVYHENCDCPLQDSAAWLREMSCPETIAQIQRDLAHFPAVDPEKIAVEIP
QRFGQRQSLCHYTLKDNKVYIKTHGEHVGFRIFMDAILLSLTRKVKMPDVEFFVNLGDWP
LEKKKSNSNIHPIFSWCGSTDSKDIVMPTYDLTDSVLETMGRVSLDMMSVQANTGPPWES
KNSTAVWRGRDSRKERLELVKLSRKHPELIDAAFTNFFFFKHDESLYGPIVKHISFFDFF
KHKYQINIDGTVAAYRLPYLLVGDSVVLKQDSIYYEHFYNELQPWKHYIPVKSNLSDLLE
QLKWAKDHDEEAKKIAKAGQEFARNNLMGDDIFCYYFKLFQEYANLQVSEPQIREGMKRV
EPQTEDDLFPCTCHRKKTKDEL
Download sequence
Identical sequences H2NK93
XP_002824457.1.23681 ENSPPYP00000006251 9600.ENSPPYP00000006251

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]