SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000006264 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000006264
Domain Number 1 Region: 1166-1278
Classification Level Classification E-value
Superfamily C-type lectin-like 4.47e-47
Family Noncollagenous (NC1) domain of collagen IV 0.000000497
Further Details:      
 
Domain Number 2 Region: 1054-1163
Classification Level Classification E-value
Superfamily C-type lectin-like 5.42e-45
Family Noncollagenous (NC1) domain of collagen IV 0.000000531
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000006264   Gene: ENSPPYG00000005496   Transcript: ENSPPYT00000006511
Sequence length 1279
Comment pep:known_by_projection chromosome:PPYG2:13:112858782:112986407:-1 gene:ENSPPYG00000005496 transcript:ENSPPYT00000006511 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPRLSVWLLLLPAALLLHEEHSRAAAKGGCAGSGCGKCDCHGVKGQKFPGLPGQPGPPG
LPVPGQAGAPGFPGERGEKGDRGFPTSLPGPSERDGLPGPPGIVECQPGPPGDQGPPGIP
GQPGLIGEIGEKGQKGESCLICDIDGYRGPPGPQGPPGEIGFPGQPGAKGDRGLPGRDGV
AGVPGPQGTPGLIGQPGAKGEPGEIYFDLRLKGDKGDPGFPGQPGMPGRAGSPGRDGHPG
LPGPKGSPGSVGLKGERGPPGGVGFPGSRGDTGPPGPPGYGPTGPIGDKGQAGFPGGPGS
PGLPGPKGEPGKVVPLPGPPGAEGLPGSPGFPGPQGDRGFPGTPGRPGLPGEKGAVGQPG
IGFPGPPGPKGVDGLPGDMGPPGTPGRPGFDGLPGNPGVQGQKGEPGVGLPGLKGLPGLP
GIPGTPGEKGSIGVPGVPGEHGAIGPPGLQGIRGEPGPPGLPGSVGSPGVPGIGPPGARG
PPGGQGPPGLSGPPGIKGEKGFPGFPGLDMPGPKGDKGAQGLPGITGQSGLPGLPGQQGA
PGIPGFPGSKGEMGVMGTPGQPGSPGPVGAPGLPGEKGDHGFPGSSGPRGDPGFKGDKGD
VGLPGKPGSMDKVDMGSMKGQKGDQGEKGQIGPIGEKGSRGDPGTPGVPGKDGQAGQPGQ
PGPKGDPGISGTPGAPGLPGPKGSVGGMGLPGTPGEKGVPGIPGLQGSPGLPGDKGAKGE
KGQAGPPGIGIPGLRGEKGDQGLVGFPGSPGEKGEKGSIGIPGMPGSPGLKGSPGSVGYP
GSPGLPGEKGDKGLPGLDGIPGVKGEAGLPGTPGPTGPAGQKGEPGSDGIPGSAGEKGEP
GSKGEVGFPGLAGSPGIPGSKGEQGFMGPPGPQGQPGLPGSPGHATEGPKGDRGPQGQPG
LPGIGGSPGITGSKGDMGPPGVPGFQGPKGLPGLQGIKGDQGDQGVPGAKGLPGPPGPPG
PYDIIKGEPGLPGPEGPPGLKGLQGLPGPKGQQGVTGLVGIPGPPGIPGFDGAPGQKGEM
GPAGPTGPRGFPGPPGPDGLPGSMGPPGTPSVDHGFLVTRHSQTIDDPQCPSGTKILYHG
YSLLYVQGNERAHGQDLGTAGSCLRKFSTMPFLFCNINNVCNFASRNDYSYWLSTPEPMP
MSMAPITGDNIRPFISRCAVCEAPAMVMAVHSQTIQIPPCPSGWSSLWIGYSFVMHTSAG
AEGSGQALASPGSCLEEFRSAPFIECHGRGTCNYYANAYSFWLATIERSEMFKKPTPSTL
KAGELRTHVSRCQVCMRRT
Download sequence
Identical sequences H2NKA6
ENSPPYP00000006264 9600.ENSPPYP00000006264 ENSPPYP00000006264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]