SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000006266 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000006266
Domain Number 1 Region: 1580-1693
Classification Level Classification E-value
Superfamily C-type lectin-like 3.06e-45
Family Noncollagenous (NC1) domain of collagen IV 0.000000433
Further Details:      
 
Domain Number 2 Region: 1473-1579
Classification Level Classification E-value
Superfamily C-type lectin-like 1.7e-42
Family Noncollagenous (NC1) domain of collagen IV 0.000000831
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000006266   Gene: ENSPPYG00000005497   Transcript: ENSPPYT00000006513
Sequence length 1694
Comment pep:known_by_projection chromosome:PPYG2:13:112986297:113212702:1 gene:ENSPPYG00000005497 transcript:ENSPPYT00000006513 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRDQRAVAGPALRRWLLLGTVTVGFLAQSVLAGVKKFDVPCGGRDCSGGCQCYPEKGGR
GQPGPVGPQGYNGPPGLQGFPGLQGRKGDKGERGAPGITGPKGDVGARGVSGFPGADGIP
GHPGQGGPRGRPGYDGCNGTQGDSGPQGPPGSEGFTGPPGPQGPKGQKGEPYALPKEERD
RYRGEPGEPGLVGFQGPPGRPGYVGQMGPVGAPGRPGPPGPPGPKGQQGNRGLGFYGVKG
EKGDVGQPGPNGIPSDTLHPIIAPTRVTFHPDQYKGEKGSEGEPGIRGISLKGEEGIMGF
PGPRGYPGLSGEKGSPGQKGEAGDPGPPGPPAYSPHPSLAKGARGDPGFPGAQGEPGSQG
EPGDPGLPGPPGLSIGDGDQRRGLPGEMGPKGFIGDPGIPALYGGPPGPDGKRGPPGPPG
LPGPPGPDGFLFGLKGAEGGVGFPGLPGSPGARGPKGWKGDAGDCRCTEGDEAIRGLPGL
PGPKGFAGINGEPGTKGDKGDPGQHGLPGFPGLKGVPGNVGAPGPKGAKGDSRTITTKGE
RGQPGVPGVPGMKGDDGSPGRDGLDGFPGLPGPPGDGIKGPPGDPGYPGIPGTKGTPGEM
GPPGLGLPGLKGQRGFPGDAGLPGPPGFLGPPGPAGTPGQIDCDTDVKRAIGGDRQEVIQ
PGCIGGPKGLPGLPGPPGPTGTKGLRGIPGFSGADGGPGPKGLPGDPGREGFPGPPGFIG
PRGSKGAVGLPGPDGSPGPIGLPGPDGPPGERGLPGEVLGAQPGPRGDAGVPGQPGLKGL
PGDRGSPGFRGSQGMPGMPGLKGQPGLPGPSGQPGLYGPPGLHGFPGAPGQEGPLGLPGI
PGREGLPGDRGDPGDTGAPGPVGMKGLSGDRGDAGFTGERGHPGSPGFKGIDGMPGTPGL
KGDRGSPGMDGFQGMPGLKGRPGFPGSKGEAGFFGIPGLKGLAGEPGFKGSRGDPGPPGP
PPVILPGMKDIKGEKGDEGPMGLKGYLGAKGIQGMPGIPGLSGIPGLPGRPGHIKGVKGD
IGAPGIPGLPGFPGVAGPPGITGFPGFIGSRGDKGAPGRAGLYGEIGPTGDFGDIGDTIN
LPGRPGLKGERGTTGIPGLKGFFGEKGTEGDIGFPGITGVTGVQGPPGLKGQTGFPGLTG
PPGSQGESGRIGLPGGKGDDGWPGAPGLPGFPGLRGIRGLHGLPGTKGFPGSPGADIHGD
PGFPGPPGERGEPGEANTLPGPVGVPGQKGDQGAPGERGPPGSPGLQGFPGITPPSNISG
VPGDKGAPGIFGLKGYRGPPGPPGSAALPGSKGDTGNPGAPGTPGTKGWAGDAGPQGRPG
VFGLPGEKGPRGEQGFMGNTGPTGAVGDRGPKGPKGDPGFPGAPGTVGAPGIAGIPQKIA
VQPGTVGPQGRRGHPGAPGEMGPQGPPGEPGFRGAPGKAGPQGRGGVSAVPGFRGDEGPI
GHQGPIGQEGAPGRPGSPGLPGMPGRSVSIGYLLVKHSQTDQEPMCPVGMNKLWSGYSLL
YFEGQEKAHNQDLGLAGSCLARFSTMPFLYCNPGDVCYYASRNDKSYWLSTTAPLPMMPV
AEDEIKPYISRCSVCEAPAVAIAVHSQDVSIPHCPAGWRSLWIGYSFLMHTAAGDEGGGQ
SLVSPGSCLEDFRATPFIECNGGRGTCHYYANKYSFWLTTIPEQSFQGSPSADTLKAGLI
RTHISRCQVCMKNL
Download sequence
Identical sequences H2NKA8
ENSPPYP00000006266 ENSPPYP00000006266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]