SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000006292 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000006292
Domain Number 1 Region: 201-481
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.86e-79
Family Eukaryotic proteases 0.00000000689
Further Details:      
 
Domain Number 2 Region: 53-116
Classification Level Classification E-value
Superfamily GLA-domain 1.37e-24
Family GLA-domain 0.0000908
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000006292   Gene: ENSPPYG00000005519   Transcript: ENSPPYT00000006540
Sequence length 496
Comment pep:known_by_projection chromosome:PPYG2:13:115735651:115749754:1 gene:ENSPPYG00000005519 transcript:ENSPPYT00000006540 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNVNRQGQHCRDFIMVSQALRLLCLLLGLQGCLAAVFITQEEAHGVLHRRRRANTFLEE
LRPGSLERECKEEQCSFEEAREIFKDLERTKLFWISYSDGDQCASSPCQNGGSCKDQLQS
YICFCLPDFEGRNCEMSEESPARWRRLKREASCWSSGSRTPGDLCSTLVPSRPDKDDQLI
CVNENGGCEQYCSDHTGAKRSCWCHEGYSLLADGVSCTPTVEYPCGKIPILEKRNASKPQ
GRIVGGKVCPKGECPWQVLLLVNGAQLCGGTLINTIWVVSAAHCFDKIKNWRNLIAVLGE
HDLSERDGDEQSRRVAQVIIPSTYVPGTTNHDIALLRLHQPVVLTDHVVPLCLPERTFSE
RTLAFVRFSLVSGWGQLLDRGATALELMALNVPRLMTQDCLQQSRKVGDSPNITEYMFCA
GYSDGSKDSCKGDSGGPHATRYRGTWYLTGIVSWGQGCAAVGHFGVYTRVSQYIEWLQKL
MCSEPRPGVLLRAPFP
Download sequence
Identical sequences H2NKD4
ENSPPYP00000006292 ENSPPYP00000006292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]