SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000006293 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000006293
Domain Number 1 Region: 145-174,227-467
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.84e-81
Family Eukaryotic proteases 0.00000000722
Further Details:      
 
Domain Number 2 Region: 40-103
Classification Level Classification E-value
Superfamily GLA-domain 4.37e-26
Family GLA-domain 0.0000618
Further Details:      
 
Domain Number 3 Region: 93-124
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000324
Family EGF-type module 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000006293   Gene: ENSPPYG00000005520   Transcript: ENSPPYT00000006541
Sequence length 488
Comment pep:known_by_projection chromosome:PPYG2:13:115751662:115779545:1 gene:ENSPPYG00000005520 transcript:ENSPPYT00000006541 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRPLHLVLLSASLAGLLLPGESLFIRKEQANNILVRVRRANSFLEEMKKGHLERECMEE
TCSYEEAREVFEDSDKTNEFWNKYKDGDQCETSPCQNQGKCKDGLGEYTCTCLEGFEGKN
CELFTRKLCSLDNGDCDQFCHEEQNSVVCSCARGYTLADNSKACIPTGPYPCGKQTLERR
KRSVAQATNSSREAPNNITWKPYDAADLDPTENPFDLLDFNQTQPERGDNNLVRIVGGRE
CKDGECPWQALLINEENEGFCGGTILSEFYILTAAHCLYQAKRFKVRVGDRNTEQEEGGE
AVHEVEVVIKHNRFTKETYDFDIAVLRLKTPITFRMNVAPACLPERDWAESTLMTQKTGI
VSGFGRTHEKGRQSTRLKMLEVPYVDRNSCKLSSSFIITQNMFCAGYHARQEDACQGDSG
GPHVTRFKDTYFVTGIVSWGEGCARKGKYGIYTKVTAFLKWIDRSMKTRGLPKAESHAPE
VITSSPLK
Download sequence
Identical sequences H2NKD5
ENSPPYP00000006293 ENSPPYP00000006293 9600.ENSPPYP00000006293 XP_002824495.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]