SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000006294 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000006294
Domain Number 1 Region: 43-104
Classification Level Classification E-value
Superfamily GLA-domain 1.96e-22
Family GLA-domain 0.00053
Further Details:      
 
Domain Number 2 Region: 137-274
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.53e-22
Family Eukaryotic proteases 0.0053
Further Details:      
 
Domain Number 3 Region: 93-129
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000012
Family EGF-type module 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000006294   Gene: ENSPPYG00000005521   Transcript: ENSPPYT00000006542
Sequence length 335
Comment pep:known_by_projection chromosome:PPYG2:13:115787320:115801705:1 gene:ENSPPYG00000005521 transcript:ENSPPYT00000006542 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGCVPLLQGLVLVLAFHRAEPSVFLPASKANDVLVRWKRAGSYLLEELFEGNLEKECYE
EICVYEEAREVFENEVVTDEFWRRYKGGSPCISQPCLHNGSCQDSIWGYTCTCSPGYEGS
NCELAKNECHPERIDGCQHFCLPGQESYTCSCAQGYRLGEDHKQCVPHDQCACGMLTSEK
RALDLQDLPWQVKLTNSEGKDFCGGVIIQENFVLTTAKCSLLHRNISVKTYFNRTSQDPL
MIKITHVHVHMRYDADTGENDLSLLELEWPIQCPGPTVREAAWRPCTGWREMWSPENTEA
PGSSRGSWARSQQEGRLAWFLSPRSPGTHSGLNRP
Download sequence
Identical sequences H2NKD6
ENSPPYP00000006294 ENSPPYP00000006294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]