SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000006299 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000006299
Domain Number 1 Region: 1-349
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 8.63e-65
Family ADP-ribosylglycohydrolase 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000006299   Gene: ENSPPYG00000005526   Transcript: ENSPPYT00000006547
Sequence length 352
Comment pep:known_by_projection chromosome:PPYG2:13:116072600:116101287:-1 gene:ENSPPYG00000005526 transcript:ENSPPYT00000006547 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKFKAAMLLGSVGDALGYRNVCKENSTVGMKIQEELQRSGGLDHLVLSPGEWPVSDNTI
MHIATAEALTTDYWCLDDLYREMVRCYVEIVEKLPERRPDPATIEGCAQLKPNNYLLAWH
TPFNEKGSGFGAATKAMCIGLRYWKPERLETLIEVSVECGRMTHNHPTGFLGSLCTALFV
SFAAQGKPLVQWGRDMLRAVPLAEEYCKKTIRHTAEYQEHWFYFEAKWQFYLEERKISKD
SENKAIFPDNYDAEEREKWMDGWVGRWMGGWMDGFWMMAPGVLRRPWSGGAHCDCCLCVS
GESAATGTIAGCLFGLLYGLDLVPKGLYQDLEDKEKLEDLGAALYRLSTEEK
Download sequence
Identical sequences H2NKE1
ENSPPYP00000006299 ENSPPYP00000006299 9600.ENSPPYP00000006299

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]