SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000006491 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000006491
Domain Number 1 Region: 2-210
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.21e-64
Family Eukaryotic proteases 0.0000000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000006491   Gene: ENSPPYG00000005709   Transcript: ENSPPYT00000006747
Sequence length 212
Comment pep:known_by_projection chromosome:PPYG2:14:23987463:23989570:-1 gene:ENSPPYG00000005709 transcript:ENSPPYT00000006747 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIK
QFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPLPSQFNFVPPGRMCRVAGWGRTGVL
KPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQG
IVSYGRSDAKPPAVFTRISHYRPWINQILQAN
Download sequence
Identical sequences H2NKX6
ENSPPYP00000006491 ENSPPYP00000006491

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]