SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000006492 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000006492
Domain Number 1 Region: 3-198
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.01e-53
Family Eukaryotic proteases 0.000000105
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000006492   Gene: ENSPPYG00000005710   Transcript: ENSPPYT00000006748
Sequence length 227
Comment pep:known_by_projection chromosome:PPYG2:14:24057368:24059659:-1 gene:ENSPPYG00000005710 transcript:ENSPPYT00000006748 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPLLLLLAFLLPTGAEAGEIIGGRESRPHSRPYMAYLQIQSPAGQSRCGGFLVREDFVL
TAGHCWGSDINVTLGAHNVRRRESTQQHITVRRAIRHPQYNQQLIQNDIMLLQLSRRVRR
NRNVNPVALPRAQEGLRPGTRCTVAGWGLVSMRRRTDTLREVQLRVQRDSQCRRIFPFYD
PRTQICVGDRRERKGAFKVRHGHWPTHSGREGPVQSQAVRTDSIPTA
Download sequence
Identical sequences H2NKX7
ENSPPYP00000006492 ENSPPYP00000006492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]