SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000006494 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000006494
Domain Number 1 Region: 39-280
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.69e-71
Family Eukaryotic proteases 0.000000014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000006494   Gene: ENSPPYG00000005712   Transcript: ENSPPYT00000006750
Sequence length 281
Comment pep:known_by_projection chromosome:PPYG2:14:24116802:24120122:-1 gene:ENSPPYG00000005712 transcript:ENSPPYT00000006750 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSLSPLHLFPLPRAKRQQGGNNSSSNQGSLPEKMQPILLLLAFLLLPRADAGEIIGGHE
AKPHSRPYMAYLMIWDQKSLKRCGGFLIREDFVLTAAHCWGSSINVTLGAHNIKEQEQTQ
QLIPVKRAVRHPAYNPKNFSNDIMLLQLEKKAKRTTAVQPLRLPSNKAQVKPGQACSVAG
WGQTAPTGKYSHTLQEVEMTVQEDRKCKSDLRHYYDSTIELCVGDPEIKKASFKGDSGGP
LVCNKVAQGIVSYGRNNGMPPRVCTKVSSFVHWIKKTMKRH
Download sequence
Identical sequences H2NKX9
9600.ENSPPYP00000006494 ENSPPYP00000006494 ENSPPYP00000006494 XP_002824669.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]