SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000006683 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000006683
Domain Number 1 Region: 242-342
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 6.41e-29
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0000121
Further Details:      
 
Domain Number 2 Region: 96-207
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 8.64e-17
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.032
Further Details:      
 
Domain Number 3 Region: 15-71
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000008
Family HLH, helix-loop-helix DNA-binding domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000006683   Gene: ENSPPYG00000005881   Transcript: ENSPPYT00000006946
Sequence length 735
Comment pep:known chromosome:PPYG2:14:62453741:62505042:1 gene:ENSPPYG00000005881 transcript:ENSPPYT00000006946 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGAGGANDKKKISSERRKEKSRDAARSRRSKESEVFYELAHQLPLPHNVSSHLDKASVM
RLTISYLRVRKLLDAGDLDIEDEMKAQMNCFYLKALDGFVMVLTDDGDMIYISDNVNKYM
GLTQFELTGHSVFDFTHPCDHEEMREMLTHRNGPVKKGKEQNTQRSFFLRMKCTLTSRGR
TMNIKSATWKVLHCTGHIHVYDTNSNQPQCGYKKPPMTCLVLICEPIPHPSNIEIPLDSK
TFLSRHSLDMKFSYCDERITELMGYEPEELLGRSIYEYYHALDSDHLTKTHHDMFTKGQV
TTGQYRMLAKRGGYVWVETQATVIYNTKNSQPQCIVCVNYVVSIVIFHTITSSIEDENCN
FKVENILMYKKVEEVSIVDCKDNSDLCENPCGRAQWLTPVIPALWEAEAGGSLEVRNTET
DDQQLEEVPLYNDVMLPSPNEKLQNINLAMSPLPTAETPKPLRSSADPALNQEVALKLEP
NPESLELSFTMPQIQDQPPSPSDGSTRQSSPEPNSPSEYCFYVDSDMVNEFKLELVEKLF
AEDTEAKNPFSTQDTDLDLEMLAPYIPMDDDFQLRSFDQLSPLESSSASPESASPQSTVT
VFQQTQIQEPTANATTTTATTDELKTVTKDCMEDIKILIASPSPTHIHKETTSATSSPYR
DTQSRTASPNRAGKGVIEQTEKSHPRSPNVLSVALSQRTTVPEEELNPKILALQNAQRKR
KMEHDGSLFQAVGII
Download sequence
Identical sequences H2NLG0
ENSPPYP00000006683 ENSPPYP00000006683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]