SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000006707 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000006707
Domain Number 1 Region: 4-91
Classification Level Classification E-value
Superfamily POZ domain 4.45e-23
Family BTB/POZ domain 0.0071
Further Details:      
 
Domain Number 2 Region: 236-260,344-371
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000111
Family Classic zinc finger, C2H2 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000006707   Gene: ENSPPYG00000005900   Transcript: ENSPPYT00000006970
Sequence length 435
Comment pep:known_by_projection chromosome:PPYG2:14:65392881:65396788:-1 gene:ENSPPYG00000005900 transcript:ENSPPYT00000006970 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTASHSLVLLQQLNMQREFGFLCDCTVAIGDVYFKAHRAVLAAFSNYFKMIFIHQTSEC
IKIQPTDIQPDIFSYLLHIMYTGKGPKQIVDHSRLEEGIRFLHADYLSHIATEMNQVFSP
ETVQSSNLYGIQISTTQKTVVKQGLEVKEAPSSNSGNRAALQGDHPQLQLSLAIGLDDGT
ADQQRACPATQALEEHQKPPVSIKQERCDPESVISQSHPSPSSEVTGPTFTENSIKIHLC
HYCGERFDSRSNLRQHLHTHVSGSLPFGVPASILESNDLGEVHPLNENSEALECRRLSSF
IVKENEQQPDHTNRGTTEPLQISQVSLISKDTEPVELNCNFSFSRKRKMSCTICGHKFAR
KSQLLEHMYTHKGKSYRYNRCQRFGNALAQRFQPYCDSWSDVSLKSSRLSQEHLDLPCAL
ESELTQENVDTILVE
Download sequence
Identical sequences H2NLI3
XP_002824891.1.23681 XP_009247431.1.23681 XP_009247432.1.23681 XP_009247434.1.23681 9600.ENSPPYP00000006707 ENSPPYP00000006707 ENSPPYP00000006707

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]