SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000006871 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000006871
Domain Number 1 Region: 319-376
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 1.38e-22
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.0000596
Further Details:      
 
Domain Number 2 Region: 7-51
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.00000000000000278
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000006871   Gene: ENSPPYG00000006041   Transcript: ENSPPYT00000007140
Sequence length 376
Comment pep:known chromosome:PPYG2:14:82462968:82508740:-1 gene:ENSPPYG00000006041 transcript:ENSPPYT00000007140 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANSANTNTVPKLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTLWENKLMQSRAVDGFH
SEEQQLLLQVQQQHQPQQQQHHHHHHHQQAQPQQTVPQQAQTQQVLIPASQQATAPQVIV
PDSKLIQHMNASNMSAAATAATLALPAGVTPVQQILTNSGQLLQVVRAANGAQYIFQPQQ
SVVLQQQVIPQMQPGGVQAPVIQQVLAPLPGGISPQTGVIIQPQQILFTGNKTQVIPTTV
AAPTPAQAQITATGQQQPQAQPAQTQAPLVLQVDGTGDTSSEEDEDEEEDYDDDEEEDKE
KDGAEDGQVEEEPLNSEDDVSDEEGQELFDTENVVVCQYDKIHRSKNKWKFHLKDGIMNL
NGRDYIFSKAIGDAEW
Download sequence
Identical sequences A0A096NRB8 A0A0D9RGW3 A0A2K5EW71 A0A2K5P1M3 A0A2K5RU24 A0A2K5TKH7 A0A2K6AX07 A0A2K6LLF1 H2NLY7 I0FLS7 P52655
ENSPANP00000015588 ENSPPYP00000006871 5iy6_N 5iy7_N 5iy8_N 5iy9_N 5iya_N 5iyb_N 5iyc_N 5iyd_N ENSP00000452454 ENSPPYP00000006871 ENSP00000298173 ENSMMUP00000029131 ENSP00000452454 gi|7706735|ref|NP_056943.1| NP_001244639.1.72884 NP_056943.1.87134 NP_056943.1.92137 XP_003808944.1.60992 XP_005562006.1.63531 XP_007985678.1.81039 XP_011715639.1.29376 XP_011926463.1.92194 XP_012332320.1.9421 XP_017361434.1.71028 XP_017729338.1.44346 9544.ENSMMUP00000029131 9600.ENSPPYP00000006871 9606.ENSP00000298173 ENSMMUP00000029130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]