SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000006882 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000006882
Domain Number 1 Region: 53-190,224-435
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.16e-48
Family WD40-repeat 0.0013
Further Details:      
 
Domain Number 2 Region: 713-812,971-1137,1206-1267
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 2.82e-46
Family Quinoprotein alcohol dehydrogenase-like 0.025
Further Details:      
 
Domain Number 3 Region: 1574-1648,1700-1845,1903-1971
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.83e-37
Family WD40-repeat 0.016
Further Details:      
 
Domain Number 4 Region: 1398-1559,1608-1776
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.57e-31
Family Quinoprotein alcohol dehydrogenase-like 0.029
Further Details:      
 
Domain Number 5 Region: 365-593
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.66e-19
Family WD40-repeat 0.0077
Further Details:      
 
Domain Number 6 Region: 868-1026
Classification Level Classification E-value
Superfamily Soluble quinoprotein glucose dehydrogenase 0.000000262
Family Soluble quinoprotein glucose dehydrogenase 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000006882   Gene: ENSPPYG00000006054   Transcript: ENSPPYT00000007155
Sequence length 1977
Comment pep:known_by_projection chromosome:PPYG2:14:90151261:90366802:-1 gene:ENSPPYG00000006054 transcript:ENSPPYT00000007155 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAARSAPSCHLRLEWVYGYRGHQCRNNLYYTAAKEIVYFVAGVGVVYSPREHRQKFYRGH
SDDIISLALHPERVLVATGQVGKEPYICIWDSYTVQTISVLKDVHTHGIACLAFDLDGQR
LVSVGLDSKNAVCVWDWKRGKMLSMAPGHTDRIFDISWDLYQPNKLVSCGVKHIKFWSLC
GNALTPKRGVFGKTGDLQTILCLACAKDELTYSGALNGDIYVWKGINLIRTIQGAHAAGI
FSMNACEEGFATGGRDGCIRLWDLTFKPITVIDLRETDQGYKGLSVRSVCWRGDHILVGT
QDSEIFEIVVQERNKPFLIMQGHCEGELWALAVHPTKPLAVTGSDDRSVRIWSLADHALI
ARCNMEEPIRCAAVNADGIHLALGMKDGSFTVLRVRDMTEVVHIKDRKEAIHELKYSPDG
TYLAVGCNDSSVDIYGVAQRYKKVGECLGSLSFITHLDWSSDSRYLQTNDGNGKRLFYRM
PGGKEVTSTEEIKGVHWASWTCVSGLEVNGIWPKYSDINDINSVDGNYIGQVLVTADDYG
IIKLFRYPCLRKGAKFRKYIGHSAHVTNVRWSHDYQWVISIGGADHSVFQWKFIPERKLK
DAVHIAPQESLADSHSDESDSDLSDVPELDSEIEQETQLTYRRQVYKEDLPQLKEQCKEK
QKSATSKRRERAPGNSIRLHFVHGYRGYDCRSNLFYTQIGEIVYHVAAVGVIYNRQQNTQ
RFYLGHDDDILCLTIHPLKDYVATGQVGRDPSIHIWDTETIKPLSILKGHHQYGVSAIDF
SADGKRLASVGIDDSHTIVLWDWKKGEKLSIARGSKDKIFAVKMNPYVPDKLITAGIKHM
KFWRKAGGGLIGRKGYIGTLGKNDTMMCAVYGWTEEMAFSGTSTGDVCIWRDIFLVKTVK
AHDGPVFSMHALEKGFVTGGKDGIVALWDDSFERCLKTYAIKRAALAPGSKGLLLEDNPS
IRAISLGHGHILVGTKNGEILEVDKSGPITLLVQGHMEGEVWGLATHPYLPICATVSEDK
TLRIWDLSPSHCMLAVRKLKKGGRCCCFSPDGKALAVGLNDGSFLMANADTLEDLVSFHH
RKDMISDIRFSPGSGKYLAVASHDSFIDIYNVMSSKRVGICKGATSYITHIDWDIRGKLL
QVNTGAKEQLFFEAPRGKKQTIPSVEVEKIAWASWTSVLGLCCEGIWPVIGEVTDVTASC
LTSDKMVLATGDDLGFVKLFRYPTKGKFGKFKRYVAHSTHVTNVRWTYDDSMLVTLGGTD
MSLMVWTNEMEGYREKRPCDSEESDIDSEEDGGYDSDVTRENEISYTIRALSTNIRPMFG
IKPHLQQKEPSIDERQGVVRGSRPPVSRAPPQPEKLQTNNVGKKKRPIEDLVLELIFGYR
GRDCRNNVHYLNDGDDIIYHTASVGILHNVATGSQSFYQEHNDDILCLTVNQHPKFINIV
ATGQVVLSCSLLTTAPSIHIWDAMNKQTLSILRCYHSKGVCSVSFSATGKLLLSVGLDPE
HTITIWRWQEGAKIASRAGHNQRIFVAEFRPDSDTQFVSVGVKHVKFWTLAGRALLSKKG
LLSTLEDARMQTMLAIAFGANNLTFTGTISGDVCVWKDHILCRIVARAHNGPVFAMYTTL
RDGLIVTGGKERPSKEGGAVKLWDQELRRCRAFRLETGQATDCVRSVCRGKGKILVGTRN
AEIIEVGEKNAACNILVNGHVDGPIWGLATHPSRDFFLSAAEDGTVRLWDIADKKMLNKV
NLGHAARTVCYSPEGDMVAIGMKNGEFIILLVSSLKIWGKKRDRRCAIHDIRFSPDSRYL
AVGSSENSVDFYNLTLGPTLNRISYCKDIPSFVIQMDFSADSSYLQVSSGCYKRHVYEVP
SGKHLMDHAAIDRITWATWTSILGDEVLGIWSRHAEKADVNCACVSHSGISLVTGDDFGM
VKLFDFPCPEKFAKYKRFLGHSPHVTNIRFTSGDRHVVSAGGDDCSLFVWKCVHTPH
Download sequence
Identical sequences H2NLZ8
ENSPPYP00000006882 ENSPPYP00000006882 9600.ENSPPYP00000006882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]