SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000007314 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000007314
Domain Number 1 Region: 112-251
Classification Level Classification E-value
Superfamily dUTPase-like 6.94e-49
Family dUTPase-like 0.000000131
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000007314   Gene: ENSPPYG00000006454   Transcript: ENSPPYT00000007616
Sequence length 252
Comment pep:known_by_projection chromosome:PPYG2:15:44850145:44862540:1 gene:ENSPPYG00000006454 transcript:ENSPPYT00000007616 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPLCPRPALCYHFFPSLLRSAMQNARGARQRAEAAVLSGPGQPLGRAAQHGIPRPLSSA
GRLSRGCRGASTVGAAGWKGELPKAGGCPAPGPETPTISPSKRARPAEEGGMQLRFARLS
EHATAPTRGSARAAGYDLYSAYDYTILPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKH
FIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTE
RGSGGFGSTGKN
Download sequence
Identical sequences H2NN61
9600.ENSPPYP00000007314 ENSPPYP00000007314 XP_002825465.1.23681 ENSPPYP00000007314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]