SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000007553 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000007553
Domain Number 1 Region: 2-130
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 5.76e-30
Family N-terminal domain of MutM-like DNA repair proteins 0.000000181
Further Details:      
 
Domain Number 2 Region: 133-244
Classification Level Classification E-value
Superfamily S13-like H2TH domain 2.5e-27
Family Middle domain of MutM-like DNA repair proteins 0.00000131
Further Details:      
 
Domain Number 3 Region: 248-290
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.13e-19
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.0000802
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000007553   Gene: ENSPPYG00000006658   Transcript: ENSPPYT00000007860
Sequence length 390
Comment pep:known_by_projection chromosome:PPYG2:15:72815514:72823305:1 gene:ENSPPYG00000006658 transcript:ENSPPYT00000007860 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEGPELHLASQFVNEACRALVFGGCVEKSSVSRNPEVPFESSAYRISASARGKELRLIL
SPLPGAQPPQEPLALVFRFGMSGSFQLVPREELPRHAHLRFYTAPPGLRLALCFVDIRRF
GRWDLGGKWQPGRGPCVLQEYQQFRENVLRNLADKAFDRPICEALLDQRFFNGIGNYLRA
EILYRLKIPPFEKARSVLEALQQRRPSPELTLSQKIRTKLQNPDLLELCHSVPKEVVQLG
GKGYGSESGEEDFAAFRAWLRCYGMPGMSSLQDRHGRTIWFQGDPGPLAPKGRKSHKKKS
KATQPSPEDRVEDPSPPSKAPSRTRRAKRDLSKRTATQQPEGTSLQQDPEAPTVPKKGRR
KGRQAASGHRRPRKVKADTPSLEPEGTSAS
Download sequence
Identical sequences H2NNU0
9600.ENSPPYP00000007553 ENSPPYP00000007553 XP_002825735.2.23681 XP_009248316.1.23681 ENSPPYP00000007553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]