SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000007666 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000007666
Domain Number 1 Region: 2053-2197
Classification Level Classification E-value
Superfamily C-type lectin-like 2.1e-42
Family C-type lectin domain 0.000000351
Further Details:      
 
Domain Number 2 Region: 477-583
Classification Level Classification E-value
Superfamily C-type lectin-like 7.26e-42
Family Link domain 0.0018
Further Details:      
 
Domain Number 3 Region: 150-260
Classification Level Classification E-value
Superfamily C-type lectin-like 3.45e-40
Family Link domain 0.0014
Further Details:      
 
Domain Number 4 Region: 588-703
Classification Level Classification E-value
Superfamily C-type lectin-like 1.65e-30
Family Link domain 0.0045
Further Details:      
 
Domain Number 5 Region: 261-355
Classification Level Classification E-value
Superfamily C-type lectin-like 4.97e-28
Family Link domain 0.0024
Further Details:      
 
Domain Number 6 Region: 33-151
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000983
Family V set domains (antibody variable domain-like) 0.03
Further Details:      
 
Domain Number 7 Region: 2198-2258
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000584
Family Complement control module/SCR domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000007666   Gene: ENSPPYG00000006757   Transcript: ENSPPYT00000007978
Sequence length 2283
Comment pep:known_by_projection chromosome:PPYG2:15:85483654:85520669:1 gene:ENSPPYG00000006757 transcript:ENSPPYT00000007978 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTLLWVFVTLRVITAAVTVETSDHDNSLSVSIPQPSPLRVLLGTSLTIPCYFIDPMHPV
TTAPSTAPLAPRIKWSRVSKEKEVVLLVATEGRVRVNSAYQEKVSLPNYPAIPSDATLEI
QSLRSNDSGVYRCEVMHGIEDSEATLEVVVKGIVFHYRAISTRYTLDFDKAQRACLQNSA
IIATPEQLQAAYEDGFHQCDAGWLADQTVRYPIHTPREGCYGDKDEFPGVRTYGIRDTNE
TYDVYCFAEEMEGEVFYATSPEKFTFQEAANECRRLGARLATTGQLYLAWQAGMDMCSAG
WLADRSVRYPISKARPNCGGNLLGVRTVYVHANQTGYPDPSSRYDAICYTGEDFVDIPEN
FFGVGGEEDITVQTVTWPDMELPLPRNITEGEARGSVILTVKPIFKVSPSPLEPEEPFTF
APEIGATAFPEVENETGEATRPWGFPTPGLGPATAFTSEDLVVQVTAVPGQPHLPGGVVF
HYRPGPTRYSLTFEEAQQACLRTGAVIASPEQLQAAYEAGYEQCDAGWLRDQTVRYPIVS
PRTPCVGDKDSSPGVRTYGVRPSTETYDVYCFVDRLEGEVFFATRLEQFTFQEALEFCES
HNATLATTGQLYAAWSRGLDKCYAGWLADGSLRYPIVTPRPACGGDKPGVRTVYLYPNQT
GLPDPLSRHHAFCFRGISAVPSPGEEEGGTPTSPSGVEEWIVTQVVPGVAAVPVEEETTA
VPLGETTAILEFTTEPENQTEREPVYIPVGTSPLPGILPTWPPTGAATEESTEGPSATEV
PSASEKPSPSEVPFPSEEPSPSEEPFPSVRPFPSVELFPSEEPFPSKEPSPSEEPSASEE
PYTPSPPVPSWTELLSSGEESGAPDVSGDFTGSGDVSGHLDFSGQLSGERASGLPSGDLD
SSGLTSTVASGLPVESGLASGDEERIEWSSTPTVGELPSGAEILEGSISGVGDLSGLPSG
EVLETTAPGVEDISGLPSGEVLETTAPGVEDISGLPSGEVLETTAPGVEDISGLPSGEVL
ETTAPGVEDISGLPSGEVLETTAPGVEDISGLPSGEVLETTAPGVEDISGLPSGEVLETT
APGVEDISGLPSGEVLETTAPGVEDISGLPSGEVLETTAPGVEDISGLPSGEVLETTAPG
VEDISGLPSGEVLETTAPGVEDISGLPSGEVLETTAPGVEDLSGLPSGEVLETSTSGVGD
LSGLPSGEVLETSTSAVGDLSGLPSGGEVLETSASGVEGSTGLPSGEVVETSASGIEDVS
ELPSGEGLETSASGVGDLSRLPSGEEVLEISASGVGDLSGLPSGVEGLETSASEVGTDLS
GLPSGREGLETSASGTEDLSGLPSGKEDLVGSASGDLDLGKLPSGTLGSGQAPETSGLPS
GFSGEYSGVDLGSGPSSGLPDFSGLPSGFPTVSLVDSTLVEVVTASTASELEGRGTIGIS
GAGEISGLPSSELDISGGASGLPSGTELSGQASGSPDVSGEIPGLFGVSGQPSGFPDTSG
ETSGVTELSGLSSGQPGVSGEASGVLYGTSQPFGITDLSGETSGVSDLSGQPSGLPGFSG
ATSRVPDLVSGATSGSGESSGITFVDTSLVEVTPATFKEEEGLGSVELSGLPSGEADLSG
KSGMVDVSGQFSGTVDSSGFTSQTPEFSGLPSGIAEVSGEASGAEIGSSLASGAYYGSGL
PSGFPTVSLVDRTLVESVTQAPTAQEAGEGPSGILEISGAHSGAPDMSGDHSGFLDLSGL
QSGLVEPSGEPPGTPYFSRDFASTTDVSGESSAAMGTSREASGLPEVTLITSEFVEGVTE
PTVSQELGQRPPVTHTPQLFESSGEVSAAGDISGATPVLPGSGVEVSSVPESSNETSTHP
EAGVGASAAPEASREDSGSPDLSETTSAFHEADLERSSGLGVSGSTLTFQEGKASAAPEV
SGESTTTNDVGTKAPGLPSATPTASADRTEISGDLSGHTSGLGIVISTSIPESEWTQQTQ
RPVEAHLEIESSSLLYSGEETHTVQTATSPTDASIPTSPEWKRESESTAAAPARSCAEEP
CGAGTCKETEGHVICLCPPGYTGEHCNIDQEVCEEGWNKYQGHCYRHFPDRETWVDAERR
CREQQSHLSSIVTPEEQEFVNNNAQDYQWIGLNDRTIEGDFRWSDGHPMQFENWRPNQPD
NFFAAGEDCVVMIWHEKGEWNDVPCNYHLPFTCKKGTVACGEPPVVEHARTFGQKKDRYE
INSLVRYQCTEGFVQRHMPTIRCQPSGHWEEPRITCTDPTTYKRRPQKRSSRHPRRSRPS
TAH
Download sequence
Identical sequences H2NP46
ENSPPYP00000007666 9600.ENSPPYP00000007666 ENSPPYP00000007666

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]