SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000007668 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000007668
Domain Number 1 Region: 164-270
Classification Level Classification E-value
Superfamily C-type lectin-like 4.72e-38
Family Link domain 0.0028
Further Details:      
 
Domain Number 2 Region: 275-360
Classification Level Classification E-value
Superfamily C-type lectin-like 1.21e-29
Family Link domain 0.0011
Further Details:      
 
Domain Number 3 Region: 50-162
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000122
Family V set domains (antibody variable domain-like) 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000007668   Gene: ENSPPYG00000006758   Transcript: ENSPPYT00000007980
Sequence length 360
Comment pep:known_by_projection chromosome:PPYG2:15:85524201:85545030:-1 gene:ENSPPYG00000006758 transcript:ENSPPYT00000007980 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLLLLVPLLLLPGSYGLPFYNGFYYSSSTNDQNAGNGHGKDLLNGVKLVVETPEETLFT
YQGASVILPCHYRYEPALVSPRRVRIKWWKLSENGAPEKDVLVAIGLRHRSFGDYQGRVH
LRQDKEHDVSLEIQDLRLEDYGRYRCEVIDGLEDESGLVELELRGVVFPYQSPNGRYQLN
FHEGQQVCAEQGAVVASFEQLFRAWEEGLDWCNAGWLQDATVQYPIMLPRQPCGGPGLAP
GVRSYGPRHRRLHRYDVFCFATALKGRVYYLEHPEKLTLTEAREACQEDDATIAKVGQLF
AAWKFHGLDRCHAGWLADGSVRYPVVHPHPNCGPPEPGVRSFGFPDPQSRLYGVYCYRQH
Download sequence
Identical sequences H2NP48
ENSPPYP00000007668 ENSPPYP00000007668 XP_002825843.1.23681 9600.ENSPPYP00000007668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]