SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000007699 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000007699
Domain Number 1 Region: 553-1080
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 2.35e-154
Family alpha-mannosidase, C-terminal domain 0.00000112
Further Details:      
 
Domain Number 2 Region: 124-430
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 1.02e-107
Family alpha-mannosidase 0.000000018
Further Details:      
 
Domain Number 3 Region: 433-547
Classification Level Classification E-value
Superfamily Families 57/38 glycoside transferase middle domain 7.85e-29
Family alpha-mannosidase, domain 2 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000007699   Gene: ENSPPYG00000006787   Transcript: ENSPPYT00000008013
Sequence length 1081
Comment pep:known_by_projection chromosome:PPYG2:15:87618163:87637883:1 gene:ENSPPYG00000006787 transcript:ENSPPYT00000008013 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLKKQVTVCGAAIFCVAVFSLYLMLDRVQHDPTRHQNGGNFPRSQISVLQNRIEQLEQL
LEENHEIISHIKDSVLELTANAEGPPAMLPYYTVNGSWVVPPEPRPSFFSISPQDCQFAL
GGRGQKPELQMLTVSEELPFDNVDGGVWRQGFDISYDPHDWDAEDLQVFVVPHSHNDPGW
IKTFDKYYTEQTQHILNSMVSKLQEDPRRRFLWAEVSFFAKWWDNINAQKRAAVRRLVGN
GQLEIATGGWVMPDEANSHYFALIDQLISDSSTDIFCHMMPFYSYDVPHTCGPDPKICCQ
FDFKRLPGGRINCPWKVPPRAITEANVAERAALLLDQYRKKSRLFRSNVLLVPLGDDFRY
DKPQEWDAQFFNYQRLFDFFNSRPDLHVQAQFGTLSDYFDALYKRTGVEPGARPPGFPVL
SGDFFSYADREDHYWTGYYTSRPFYKSLDRVLEAHLRGAEVLYSLAAAHARRSGLAGRYP
LSDFTLLTEARRTLGLFQHHDAITGTAKEAVVVDYGVRLLRSLVNLKQVIIHAAHYLVLG
DKETYHFDPEAPFLQVDDTRLSHDALPERTVIQLDSSPRFVVLFNPLEQERFSMVSLLVN
SPRVRVLSEEGQPLAVQIGAHWSSATEAVPDVYQVSVPVRLPALGLGVLQLQLGLDGHRT
LPSSVRIYLHGRQLSVSRHEAFPLRVIDSGTSDFALSNRYMQVWFSGLTGLLKSIRRVDE
EQEQQVDMQVLVYGTRTSKDKSGAYLFLPDGEAKPYVPKEPPVLRVTEGPFFSEVVVYYE
HIHQAVRLYNLPGVEGLSLDISSLVDIRDYVNKELALRIHTDIDSQGIFFTDLNGFQVQP
RRYLKKLPLQANFYPMPVMAYIQDAQKRLTLHTAQALGVSSLKDGQLEVILDRRLMQDDN
RGLGQGLKDNKRTCNRFRLLLERRTVGSEVQDSHSTSYPSLLSHLTSMYLNTPALALPVA
RTQLPGPGLRSFHPLASSLPCDFHLLNLRTLQAEEDTLPSAETALILHRKGFDCGLEAKN
LGFNCTTSQGKVALGSLFHGLDVVFLQPTSLTLLYPLASPSNSTDVYLEPMEIATFRLRL
G
Download sequence
Identical sequences H2NP77
9600.ENSPPYP00000007699 ENSPPYP00000007699 ENSPPYP00000007699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]