SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000007740 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000007740
Domain Number 1 Region: 25-427
Classification Level Classification E-value
Superfamily ALDH-like 2.36e-143
Family ALDH-like 0.0000000000769
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000007740   Gene: ENSPPYG00000006823   Transcript: ENSPPYT00000008057
Sequence length 431
Comment pep:known_by_projection chromosome:PPYG2:15:98093423:98129117:1 gene:ENSPPYG00000006823 transcript:ENSPPYT00000008057 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATANGAVENGQPDGKPPAPPRPIRNLEVKFTKIFINNEWHESKSGKKFATYNPSTLEKI
CEVEEGDKPDVDKAVEAAQAAFQRGSPWRRLDALSRGRLLHQLADLVERDRATLAALETM
DTGKPFLHAFFIDLEGCIRTLRYFAGWADKIQGKTIPTDDNVVCFTRHEPIGVCGAITPW
NFPLLMLVWKLAPALCCGNTMVLKPAEQTPLTALYLGSLIKEAGFPPGVVNIVPGFGPTV
GAAISSHPQINKIAFTGSTAVGKLVKEAASRSNLKRVTLELGGKNPCIVCADADLDLAVE
CAHQGVFFNQGQCCTAASRVFVEEQVYSEFVRRSVEYAKKRPVGDPFDVKTEQGPQIFGP
VQPILKFKSIEEVIKRANSTDYGLTAAVFTKNLDKALKLASALESGTVGEYALAEYTEVK
TVTIKLGDKSP
Download sequence
Identical sequences H2NPB8
ENSPPYP00000007740 9600.ENSPPYP00000007740 ENSPPYP00000007740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]