SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000007860 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000007860
Domain Number 1 Region: 8-269
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.07e-87
Family Eukaryotic proteases 0.0000255
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000007860   Gene: ENSPPYG00000006942   Transcript: ENSPPYT00000008187
Sequence length 321
Comment pep:known chromosome:PPYG2:16:1240055:1244218:-1 gene:ENSPPYG00000006942 transcript:ENSPPYT00000008187 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALGACGLLLLLAVPGVSLRALQPGCGQPQVSDAVGRIVGGHAAPASAWPWQASLRLRRV
HVCGGSLLSPQWVLTAAHCFSGSLNSSDYQVHLGELEITLSPHFSTVRQIILHSSLPGPP
GSSRDIALVRLSVPVTLSSRILPVCLPEASDDFCPGTQCWVTGWGYTQEGEPLPPPYSLQ
EVEVSVVDTETCRRDYPGPGGSILQPDMLCAQGPGDACQDDSGGPLVCQVNGAWVQAGIV
SWGEGCGRPNKPGVYTRVSAYVNWIRRHITASGGSESGYPRLPLAAGFFLPSLFLLLVSC
VLLAKCLLHPSGDGTPFPAPD
Download sequence
Identical sequences H2NPN5
9600.ENSPPYP00000007860 NP_001191241.1.23681 ENSPPYP00000007860 ENSPPYP00000007860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]