SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000007861 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000007861
Domain Number 1 Region: 3-271
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.44e-86
Family Eukaryotic proteases 0.0000000075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000007861   Gene: ENSPPYG00000006943   Transcript: ENSPPYT00000008188
Sequence length 275
Comment pep:known chromosome:PPYG2:16:1247114:1248684:-1 gene:ENSPPYG00000006943 transcript:ENSPPYT00000008188 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSLLLLALPVLASPAYAAPAPGQALQRVGIVGGQEAPRSKWPWQVSLRVHGQYWMHFCG
GSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVGRIIVHPQFYTAQTGA
DIALLELEEPVNISSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDEHLPPPFPLKQVKV
PIMENHICDAKYHLGLYTGDDVRIVRDDMLCAGNSRRDSCQGDSGGPLVCKVNGTWLQAG
VVSWGEGCAQPNRPGIYTRVTYYLDWIHRYVPKKP
Download sequence
Identical sequences A8CXJ8
ENSPPYP00000007861 NP_001153284.1.23681 9600.ENSPPYP00000007861 ENSPPYP00000007861

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]