SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000007895 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPPYP00000007895
Domain Number - Region: 83-161
Classification Level Classification E-value
Superfamily Eukaryotic RPB5 N-terminal domain 0.0301
Family Eukaryotic RPB5 N-terminal domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000007895   Gene: ENSPPYG00000006974   Transcript: ENSPPYT00000008222
Sequence length 172
Comment pep:known chromosome:PPYG2:16:2019157:2021581:1 gene:ENSPPYG00000006974 transcript:ENSPPYT00000008222 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPDSWDKDVYPEPPRRTPVLPNPIVYMMKAFDLIVDRPVTLAREFVERQHAKNRYYYYHR
QYRRVPDITECKEEDIMCMYEAEMQWRRDYKVDQEIINIMQDRLKACQVREGENYQQNCA
KEVEQFTQVAKAYQDRYQDLGVYYSARKCLAKQKQRMLQERKAAREAAAATS
Download sequence
Identical sequences H2NPR8
ENSPPYP00000007895 ENSPPYP00000007895 9600.ENSPPYP00000007895

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]