SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000007906 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000007906
Domain Number 1 Region: 99-309
Classification Level Classification E-value
Superfamily DNA-glycosylase 2.36e-60
Family Endonuclease III 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000007906   Gene: ENSPPYG00000006985   Transcript: ENSPPYT00000008233
Sequence length 312
Comment pep:known_by_projection chromosome:PPYG2:16:2108558:2116765:-1 gene:ENSPPYG00000006985 transcript:ENSPPYT00000008233 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCSPQESGMTSLSARMLTRSRSLGPRAGPRGCGEEPAPLRRREAAAEARKSHSPVKRPRK
AQRLRVAYEGSDSEKGGGAEPLKVPVWEPQGWQQQLVNIRAMRNKKDAPVDHLGTEHCYD
SSAPPKVRRYQVLLSLMLSSQTKDQVTAGAMQRLRARGLTVDSILQTDDATLGKLIYPVG
FWRSKVKYIKQTSAILQQRYGGDIPASVAELVALPGVGPKMAHLAMAVAWGTVSGIAVDT
HVHRIANRLRWTKKATKSPEETRAALEEWLPRELWHEINGLLVGFGQQTCLPVRPRCQAC
LNQALCPAAQGL
Download sequence
Identical sequences H2NPS9
9600.ENSPPYP00000007906 XP_002826033.1.23681 ENSPPYP00000007906 ENSPPYP00000007906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]