SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000007908 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000007908
Domain Number 1 Region: 3115-3219
Classification Level Classification E-value
Superfamily Lipase/lipooxygenase domain (PLAT/LH2 domain) 8.43e-27
Family Lipoxigenase N-terminal domain 0.074
Further Details:      
 
Domain Number 2 Region: 401-534
Classification Level Classification E-value
Superfamily C-type lectin-like 4.55e-25
Family C-type lectin domain 0.0019
Further Details:      
 
Domain Number 3 Region: 2023-2145
Classification Level Classification E-value
Superfamily PKD domain 6.75e-23
Family PKD domain 0.0022
Further Details:      
 
Domain Number 4 Region: 1089-1209
Classification Level Classification E-value
Superfamily PKD domain 8.24e-22
Family PKD domain 0.002
Further Details:      
 
Domain Number 5 Region: 65-158
Classification Level Classification E-value
Superfamily L domain-like 1.36e-21
Family Ngr ectodomain-like 0.011
Further Details:      
 
Domain Number 6 Region: 1682-1803
Classification Level Classification E-value
Superfamily PKD domain 1.83e-21
Family PKD domain 0.0064
Further Details:      
 
Domain Number 7 Region: 1460-1547
Classification Level Classification E-value
Superfamily PKD domain 7.98e-16
Family PKD domain 0.003
Further Details:      
 
Domain Number 8 Region: 261-356
Classification Level Classification E-value
Superfamily PKD domain 0.000000000000889
Family PKD domain 0.00000908
Further Details:      
 
Domain Number 9 Region: 1552-1633
Classification Level Classification E-value
Superfamily PKD domain 0.00000000000327
Family PKD domain 0.0077
Further Details:      
 
Domain Number 10 Region: 1014-1125
Classification Level Classification E-value
Superfamily PKD domain 0.0000000000549
Family PKD domain 0.0068
Further Details:      
 
Domain Number 11 Region: 1816-1887
Classification Level Classification E-value
Superfamily PKD domain 0.0000000000759
Family PKD domain 0.0065
Further Details:      
 
Domain Number 12 Region: 1312-1379
Classification Level Classification E-value
Superfamily PKD domain 0.000000000249
Family PKD domain 0.0046
Further Details:      
 
Domain Number 13 Region: 1223-1293
Classification Level Classification E-value
Superfamily PKD domain 0.00000000301
Family PKD domain 0.0072
Further Details:      
 
Domain Number 14 Region: 1407-1466
Classification Level Classification E-value
Superfamily PKD domain 0.00000000484
Family PKD domain 0.0054
Further Details:      
 
Domain Number 15 Region: 1889-1971
Classification Level Classification E-value
Superfamily PKD domain 0.000000405
Family PKD domain 0.008
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000007908
Domain Number - Region: 902-1015
Classification Level Classification E-value
Superfamily PKD domain 0.000127
Family PKD domain 0.0094
Further Details:      
 
Domain Number - Region: 815-865
Classification Level Classification E-value
Superfamily Thermostable phytase (3-phytase) 0.0602
Family Thermostable phytase (3-phytase) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000007908   Gene: ENSPPYG00000006987   Transcript: ENSPPYT00000008235
Sequence length 4255
Comment pep:known_by_projection chromosome:PPYG2:16:2161806:2210799:-1 gene:ENSPPYG00000006987 transcript:ENSPPYT00000008235 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPAAPARLALALGLGLWLGALAGGPGRGCGPCEPPCLCSPAPGAACHVNCSGRGLRTLG
PALRIPADATALDVSHNLLRALDVGLLANLSALAELDISNNKISTLEEGIFANLFNLSEI
NLSGNPFECDCGLAWLPRWAEEQQVRVVQPEAATCAGPGSLAGQPLLGIPLLDSGCGEEY
VACLPDNSSGTMAAVSFSAAHEGLLQPEACSAFCFSTGQGLAALSEQGWCLCGAVQPSSA
SFACLSLCSGPPPPPAPTCGGPTLLQHVFPASPGAALVGPHGPLASGQLAAFHIAAPLPV
TATRWDFGDGSPEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTNVQVEAAPATLE
LVCPSSVQSDESLELSIQNRGGSGLEAAYSIVALGEEPARVVHPLCPSDTEIFPGNGHCY
RLVVEKAAWLQAQEQCRAWAGAALAMVDSPAVQRFLVSRVTRSLDVWIGFSTVQGAEVGP
APQGEAFSLESCQNWLPGEPHPATAEHCVRLGPTGWCNTDLCSAPHSYVCELRPGGPVQD
AENLLVGAPSGDLQGPLTPLAQQDGLSAPHQPVEVMVFPGLSPSHEAFLTAAEFGTQELR
RPAQLRLQVYRLLSTAGTPENGSEPESRSLDNRTQLAPACMPGGRWCPGANVCLPLDASC
HPQACANGCTSGPGLPGAPYALWREFLFSVPAGPPAQYSVTLHSQDVLVLPGDLVGLQHD
AGPGALLRCSPAPGHPGPQAPYLSANASSWLPHLPAQLEGTRACPACALRLLAATEQLTV
LLGLRPNPGLRLPGRYEVRAEVGNGVSGHNLSCTFEVVSAVAGLRVIYPTPRDGRLYVPT
NGSALVLQVDSGANATATARWPGGNVSARFEAACPALVATFVPGCPWETNDTLFSVVALP
WLSEGEHVVDVVVENSASQANLSLRVTAEEPICGLRATPSPEARVLQGVLVRYSPVVEAG
SDMVFRWTINDKPSLTFQNVVFNVIYQSAAVFKLSLTASNHVSNVTVNYNVTVERMNRMQ
GLRVSTVPAVLCPNATLALTAGVLVDSAVEVAFLWTFGDGEQALHQFQPPYNKSFPVPDP
SVAQVLVEHNVTHTYAAPGEYILTVLASNAFENLTQQVPVSVRAALPSVAVGVSDSVLVA
GRPITFYPHPLPSPGGVLYMWDFGDGSPVLTQSQPAANHTYASRGTYHVRLEVNNTVSGA
AARADGRVFEELRGLRVDMSLAVEQGAPVVVSATVQTGDNITWTFDMGDGTVLSGPEATV
EHVYLRAQNCTVTVGAASPAGHLARSLHVLVFVLEVLRIEPAACIPMQPDARLTAYVTGN
PAHYLLDWTFGDGSSNTTVRGCPMVTHNFTRSGTFPLALVLSSRVNKAHYFTSICVEPEV
GNVTLQPERQFVQLGDEARLVACAWPPFPYRYTWDFGTEEAVPARAGGPEVTFIYRDPGS
YLVTVTASNNISAANDSALVEVQEPVVVTDINVNGSLVLELQQPYLFSAVGRGRPASYLW
DLGDGGRLEGPEVTHTYNSTGDFTVRVAGWNEVSRSEAWLNVTVKRRVRGLVVNASRTVV
PLNGSVSFSTSLEAGSDVRYSWVLCDRCTPIPGGPTISYTFRSVGTFNIIVTAENEVGSA
QDSIFVYVLQLIEGLQVAGGGRYFPTNHTVQLQAVVRDGTNISYSWTAWRDRGPALAGSG
KDFSFTALEAGTYHVQLRATNMLGSAWADCTVDFVEPVGWLMVAASPNPAAVDTSVTLSA
ELAGGSGVVYTWSLEEGQSWETPEPFTTHSFPTPGLHLVTITAGNPLGSANATVEVDVQV
PVSGLSIRASEPGGSFVAAGSSVPFWGQLATGTNVSWCWAVPGSSSKRGPHVTMVFPDAG
TFSIRLNASNAVSWVSATHNITVEEPIVGLVLWASSKVVAPGQLVHFQILLAAGSAVTFR
LVGAASPEVLPGPRFSHSFPRVGDHVVSVQGKNHVSWAQAQVRIVVLEAVSGLQVPNCCE
PGIATGTERNFTARVQRGSRVAYAWYFSLQKVQGDSLVILSGRDVTYTPVAAGLLEIQVR
AFNALGSENRTLVLEVQDAVQYVALRSGPCFTNRSVQFEAATSPSPRRVAYRWDFGDGSP
GQDTDEPRAEHSYLRPGDYRVQVNASNLVSFFVAQATVTVQVLACREPEVDVVLPLQVLM
RRSQRNYLEAHVDLRDCVTYQTEYRWEVYRTASCQRPGRPARVALPGVDVSRPQLVLPRL
ALPVGHYCFVFVVSFGDTPLARSIQANVTVAPERLVPIIEGGSYRVWSDTQDLVLDGSES
YDPNLEDGDQTPLSFHWACVASTQREAGVCALNFGPRGSSMVSIPRERLVAGVEYTFSLT
VWKAGRKEEATNQTVLIRSGRVPIVSLECVSCKAQAVYEVSRSSYVYLEGRCLNCSSGSK
RGRWAARTFSNKTLVLDETTTSTGSAGMRLVLRRGVLRDGEGYTFTLTVLGHSGEEEGCA
SIRLSPNRPPLGGSCRLFPLGAVHALTTKVHFECTGWHDAEDAGAPLVYALLLRRCRQGH
CEEFYVYKGSLSSYGAVLPPGFRPHFEVGLAVVVQDQLGAAVVALNRSLAITLPEPNGSA
TGLTVWLHGLTASVLPGLLRQADPQHVIEYSLALVTVLNEYEQALDVAAEPKHERQHRAQ
IRKNITETLVSLRVHTVDDIQQIAAALAQCMGPSRELVCRSCLKQTLHKLEAMMRILQAE
TTTGTVTPTAIGDSILNITGDLIHLASSDVWAPQPSELGAESPSRMVASQAYNLTSALMR
ILMRSRVLNEEPLTLAGEEIVAQGKRSDPRSLLCYGGTPGPGCHFSIPEAFSGALANLSD
VVQVIFLVDSNPFPFGYISNYTVSTKVASMAFQTQAGAQIPIERLASERAITVKVPNNSD
WAARGHRSSANSIVVQPQASVGAVVTLDSSNPAAGLHLQLNYTLLDGRYLSEEPEPFLAV
YLHSEPRPNEHNCSASRRIRPESLQGADHRPYTFFISPGTRDPAGSYHLNLSSHFRWSAL
EVSVGLYTSLCQYFSEEDMVWRTEGLLPLEETSPRQAVCLTRHLTAFGASLFVPPSHVRF
VFPEPTADVNYIVMLTCAVCLVTYMVMAAILHKLDQLDASRGRAIPFCGQRGRFKYEILV
KTGWGRGSGTTAHVGIMLYGVDSRSGHRHLDGDRAFHRNSLDIFRIATPHSLGSVWKIRV
WHDNKGLSPAWFLQHIIVRDLQTARSAFFLVNDWLSVETEANGGLVEKEVLAASDAALLR
FRRLLVAELQRGFFDKHIWLSIWDRPPRSRFTRIQRATCCVLLICLFLGANAVWYGAVGD
SAYSMGRVSRLSPLSVDTVAVGLVSSVVVYPIYLAILFLFRMSRSKVAGSPSPTPAGQQV
LDIDSCLDSSVLDSSFLTFSGLHAEQAFAGQMKSDLFLDDSKSLVCWPSSEGTLSWPDLL
SDPSIVGSNLRQLARGQAGHGLGPEEDGFSLASPYSPAKSFSASDEDLIQQVLAEGVSSP
APTQDTHMETDLLNSLSSTPGEKTETLALQRLGELGPPSPGLTWEQPQAARLSRTGLVEG
LRKRLLPAWCASLAHGLSLLLVAVAVAVSGWVGASFPPGVSVAWLLSSSASFLASFLGWE
PLKVLLEALYFSLVAKRLHPDEDDTLVDSPAVTPVSARVPRVRPPHGFALFLAKEEARKV
KRLHGMLRSLLVYMLFLLVTLLASYGDASCHGHAYRLQSAIKQELHSRAFLAITRSEELW
PWMAHVLLPYVHGNQSSPELGPPRLRQVRLQEALCPDPPGPRVHTCSAAGGFSTSDYDVG
WESPHNGSGTWAYSAPDLLGAWSWGSCAVYDSGGYVQELGLSLEESRDRLRFLQLHNWLD
NRSRAVFVELTRYSPAVGLHAAVTLRLEFPAAGRALAALSVRPFALRRLSAGLSLPLLTS
VCLLLALHFPAQARTWHERRWRVLPGAWAWLLVGLAASLLFLLLVKAAQQLRFVRQWSVF
GKTLCRALPELLGVTLGLVVLGVAYAQLAVLLVSSCVDSLWSVAQALLVLCPGTGFCTLC
PAESWHLSPLLCVGLWALRLWGALRLGAVILRWRYHALRGELYRPAWEPQDYEMVELFLR
RLRLWMGLSKVKEFRHKVRFEGMEPLPSRSSRGSKPCSRPCSPSLTDSTRPQRTSTSWSS
SCTVCKAAGAAGSLPDLPVAHPRACGNHCPAALPGPVGVWTWPLAPAGHPCGPRTRSTPA
ALRPPPWWGWAVESEWTPLSITFCHCQGLGPGRMAARRFPREQAGASVCLWASAL
Download sequence
Identical sequences H2NPT1
ENSPPYP00000007908 ENSPPYP00000007908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]