SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000007929 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000007929
Domain Number 1 Region: 8-204
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.95e-69
Family Eukaryotic proteases 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000007929   Gene: ENSPPYG00000007008   Transcript: ENSPPYT00000008259
Sequence length 218
Comment pep:known_by_projection chromosome:PPYG2:16:2809504:2813193:-1 gene:ENSPPYG00000007008 transcript:ENSPPYT00000008259 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SQGAKAATACGRPRMLNRMVGGQDAQEGEWPWQVSIHRNGSHFCGGSLIAERWVLTAAHC
FPNTSETSLYQVLLGARQLVQPGPHAMYARVRRVESNPLYQGMASSADVALVELEAPVTF
TNYILPVCLPDPSVIFETGMNCRVTGWGSPSEEGDSGGPLVCLVGQSWLQAGVISWGEGC
ARQNRPGVYIRVTAHHNWIHRIIPKLQFQPVRSGGQKR
Download sequence
Identical sequences H2NPV2
9600.ENSPPYP00000007929 ENSPPYP00000007929 ENSPPYP00000007929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]