SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000007938 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000007938
Domain Number 1 Region: 16-106
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.13e-22
Family Eukaryotic proteases 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000007938   Gene: ENSPPYG00000007017   Transcript: ENSPPYT00000008268
Sequence length 146
Comment pep:novel chromosome:PPYG2:16:3015241:3016911:-1 gene:ENSPPYG00000007017 transcript:ENSPPYT00000008268 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPLQGGWEDCGRPRHPGRMLAMAGWPVVDLSGARMWGLPHPPTLGAHGRPLLPEGDSGG
PLVCPINDTWIQAGIVSWGFGCARPFRPGVYTQVLSYTDWIQRTLAESHSGMSGDRPGAP
GSHSGTSRSHLVLPLELLTVCLLGSL
Download sequence
Identical sequences H2NPW1
9600.ENSPPYP00000007938 ENSPPYP00000007938 XP_009248641.1.23681 ENSPPYP00000007938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]