SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000007942 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000007942
Domain Number 1 Region: 16-130
Classification Level Classification E-value
Superfamily Kringle-like 7.97e-29
Family Kringle modules 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000007942   Gene: ENSPPYG00000007020   Transcript: ENSPPYT00000008272
Sequence length 210
Comment pep:known_by_projection chromosome:PPYG2:16:3103545:3105807:1 gene:ENSPPYG00000007020 transcript:ENSPPYT00000008272 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GDTSLQGFLFLLFLPLLQPRGASAGSLHSPGLSECFQVNGADYRGHQNRTGPRGAGRPCL
FWDQTQQHSYSSASDPQGRWGLGAHNFCRNPDGDVQPWCYVAETEEGIYWRYCDIPSCHM
PGYLGCFVDSGAPPALSGPSGTSTKLTVQVCLRFCRMKGYQLAGVEAGYACFCGSECDLA
RGRLAPATDCDQICFHPGQLCFFYGRLGVY
Download sequence
Identical sequences H2NPW5
ENSPPYP00000007942 ENSPPYP00000007942 9600.ENSPPYP00000007942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]