SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000007986 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000007986
Domain Number 1 Region: 120-341
Classification Level Classification E-value
Superfamily Heme oxygenase-like 1.11e-73
Family Eukaryotic type heme oxygenase 0.000000456
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000007986   Gene: ENSPPYG00000007061   Transcript: ENSPPYT00000008317
Sequence length 404
Comment pep:known_by_projection chromosome:PPYG2:16:4619348:4651696:1 gene:ENSPPYG00000007061 transcript:ENSPPYT00000008317 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PRPRPALRAHVAPASRPSAGLQGLRRLRESLTGTLTGGWRTGDSDLRQMESRSVAQAGVQ
WISLAHCSLHLLGSRPEEREQQEPHPAAMSAEVETSEGVDESEKKNSGALEKENQMRMAD
LSELLKEGTKEAHDRAENTQFVKDFLKGNIKKELFKLATTALYFTYSALEEEMEHNKDHP
AFAPLYFPMELHRKEALTKDMEYFFGENWEEQVQCPKAAQKYVERIHYIGQNEPELLVAH
AYTRYMGDLSGGQVLKKVAQRALKLPSTGEGTQFYLFENVDNAQQFKQLYRARMNALDLN
MKTKERIVEEANKAFEYNMQIFNELDQAGSTLARETLEDGFPVHDGKGDKRKCPFYAAEQ
DKGALEGSSCPFRTAMAVLRKPSLQFILAAGVALAAGLLAWYYM
Download sequence
Identical sequences H2NQ09
ENSPPYP00000007986 ENSPPYP00000007986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]